8p94

Cryo-EM structure of cortactin stabilized Arp2/3-complex nucleated actin branches

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin-related protein 3

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–418； UniProt 1–418

Actin-related protein 2

Homo sapiens

UniProt P61160

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–394； UniProt 1–394

Actin-related protein 2/3 complex subunit 1B

Homo sapiens

UniProt O15143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARC1B_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–372； UniProt 1–372

Actin-related protein 2/3 complex subunit 2

Homo sapiens

UniProt O15144

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARPC2_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–300； UniProt 1–300

Actin-related protein 2/3 complex subunit 3

Homo sapiens

UniProt O15145

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARPC3_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–178； UniProt 1–178

Actin-related protein 2/3 complex subunit 4

Homo sapiens

UniProt P59998

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARPC4_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–168； UniProt 1–168

Actin-related protein 2/3 complex subunit 5-like protein

Homo sapiens

UniProt Q9BPX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP5L_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–153； UniProt 1–153

Actin, cytoplasmic 1

OrganismNot specified

UniProt Q6QAQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–375； UniProt 1–375 Author chain J； PDBConstruct 1–375； UniProt 1–375 Author chain K； PDBConstruct 1–375； UniProt 1–375 Author chain N； PDBConstruct 1–375； UniProt 1–375 Author chain O； PDBConstruct 1–375； UniProt 1–375 Author chain P； PDBConstruct 1–375； UniProt 1–375 Author chain Q； PDBConstruct 1–375； UniProt 1–375 Author chain R； PDBConstruct 1–375； UniProt 1–375 Author chain S； PDBConstruct 1–375； UniProt 1–375 Author chain W； PDBConstruct 1–375； UniProt 1–375

Src substrate cortactin

Mus musculus

UniProt Q60598

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） F-actin-capping protein subunit alpha-1 × 1 （P47753） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRC8_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–546； UniProt 1–546

F-actin-capping protein subunit alpha-1

Mus musculus

UniProt P47753

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） Isoform 2 of F-actin-capping protein subunit beta × 1 （P47757） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAZA1_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–286； UniProt 1–286

Isoform 2 of F-actin-capping protein subunit beta

Mus musculus

UniProt P47757

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Actin-related protein 3 × 1 （P61158） Actin-related protein 2 × 1 （P61160） Actin-related protein 2/3 complex subunit 1B × 1 （O15143） Actin-related protein 2/3 complex subunit 2 × 1 （O15144） Actin-related protein 2/3 complex subunit 3 × 1 （O15145） Actin-related protein 2/3 complex subunit 4 × 1 （P59998） Actin-related protein 2/3 complex subunit 5-like protein × 1 （Q9BPX5） Actin, cytoplasmic 1 × 10 （Q6QAQ1） Src substrate cortactin × 1 （Q60598） F-actin-capping protein subunit alpha-1 × 1 （P47753） Phalloidin × 10 ADENOSINE-5'-DIPHOSPHATE × 12 MAGNESIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPZB_MOUSE
Isoform	P47757-2
PDB entities	11
Chains and sequence ranges	Author chain V； PDBConstruct 1–272； UniProt 1–272

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8p94
Deposition date deposition_date	2023-06-05
Structure title title	Cryo-EM structure of cortactin stabilized Arp2/3-complex nucleated actin branches
Keywords keywords	Complex, CONTRACTILE PROTEIN; CONTRACTILE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8p94__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8p94__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8p94__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	82.08 Å
Rg (electron density)	83.20 Å
Total Rg	82.94 Å
Atom count	100470
Residues	6370
Excluded volume	901270 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8p94__assembly_1__model_1`	30-meric （30）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	Actin-related protein 3
Molecular weight formula_weight	47428.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	100470

MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	unidentified baculovirus

Entity 2 Entity 2 polymer

Description description	Actin-related protein 2
Molecular weight formula_weight	44818.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	unidentified baculovirus

Entity 3 Entity 3 polymer

Description description	Actin-related protein 2/3 complex subunit 1B
Molecular weight formula_weight	41004.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	unidentified baculovirus

Entity 4 Entity 4 polymer

Description description	Actin-related protein 2/3 complex subunit 2
Molecular weight formula_weight	34386.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	unidentified baculovirus

Entity 5 Entity 5 polymer

Description description	Actin-related protein 2/3 complex subunit 3
Molecular weight formula_weight	20572.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	unidentified baculovirus

Entity 6 Entity 6 polymer

Description description	Actin-related protein 2/3 complex subunit 4
Molecular weight formula_weight	19697.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	unidentified baculovirus

Entity 7 Entity 7 polymer

Description description	Actin-related protein 2/3 complex subunit 5-like protein
Molecular weight formula_weight	16964.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	unidentified baculovirus

Entity 8 Entity 8 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,J,K,N,O,P,Q,R,S,W

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 9 Entity 9 polymer

Description description	Src substrate cortactin
Molecular weight formula_weight	61340.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	F-actin-capping protein subunit alpha-1
Molecular weight formula_weight	32980.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQVLITEHGDLGNSRFLDPRNQISFKFDHLRKEASDPQPEDVDGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPSAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEVQTTKEFIKIIESAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	Isoform 2 of F-actin-capping protein subunit beta
Molecular weight formula_weight	30669.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 polymer

Description description	Phalloidin
Molecular weight formula_weight	808.9 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,h,i,j,k,l,m

WXATCPA

Entity 13 Entity 13 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 14 Entity 14 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	130915

Cryo-EM structure of cortactin stabilized Arp2/3-complex nucleated actin branches

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin-related protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 2/3 complex subunit 1B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 2/3 complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 2/3 complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 2/3 complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 2/3 complex subunit 5-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Src substrate cortactin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin-capping protein subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer