6f1t

Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARP1 actin related protein 1 homolog A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–376； UniProt 1–376 Author chain B； PDBConstruct 1–376； UniProt 1–376 Author chain C； PDBConstruct 1–376； UniProt 1–376 Author chain D； PDBConstruct 1–376； UniProt 1–376 Author chain E； PDBConstruct 1–376； UniProt 1–376 Author chain F； PDBConstruct 1–376； UniProt 1–376 Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain I； PDBConstruct 1–376； UniProt 1–376

Actin, cytoplasmic 1

OrganismNot specified

UniProt Q6QAQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–375； UniProt 1–375

Actin related protein 10 homolog

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LHK5_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–390； UniProt 1–390

Capping protein (Actin filament) muscle Z-line, alpha 1

OrganismNot specified

UniProt A0PFK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0PFK5_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–286； UniProt 1–286

F-actin capping protein beta subunit

OrganismNot specified

UniProt A9XFX6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A9XFX6_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–272； UniProt 1–272

Dynactin 6

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0G6S1_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–190； UniProt 1–190

Dynactin subunit 5

OrganismNot specified

UniProt A0A286ZK88

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZK88_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain V； PDBConstruct 1–182； UniProt 1–182

BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1

Mus musculus

UniProt A0JNT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BICL1_MOUSE
Isoform	—
PDB entities	12, 23
Chains and sequence ranges	Author chain X； PDBConstruct 1–325； UniProt 1–325 Author chain x； PDBConstruct 1–325； UniProt 1–325

Dynactin subunit 2

OrganismNot specified

UniProt F1SKF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SKF9_PIG
Isoform	—
PDB entities	15, 16, 17, 18
Chains and sequence ranges	Author chain a； PDBConstruct 1–66； UniProt 1–66 Author chain b； PDBConstruct 1–89； UniProt 1–89 Author chain c； PDBConstruct 1–50； UniProt 1–50 Author chain d； PDBConstruct 1–26； UniProt 1–26

;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ;

Homo sapiens

UniProt Q14204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DYHC1_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain e； PDBConstruct 1–983； UniProt 1–983 Author chain f； PDBConstruct 1–983； UniProt 1–983 Author chain m； PDBConstruct 1–983； UniProt 1–983 Author chain n； PDBConstruct 1–983； UniProt 1–983

Cytoplasmic dynein 1 intermediate chain 2

Homo sapiens

UniProt Q13409

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DC1I2_HUMAN
Isoform	Q13409-3
PDB entities	20
Chains and sequence ranges	Author chain g； PDBConstruct 1–612； UniProt 1–612 Author chain h； PDBConstruct 1–612； UniProt 1–612 Author chain o； PDBConstruct 1–612； UniProt 1–612 Author chain p； PDBConstruct 1–612； UniProt 1–612

Cytoplasmic dynein 1 light intermediate chain 2

Homo sapiens

UniProt O43237

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Dynein light chain roadblock-type 1 × 4 （Q9NP97） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DC1L2_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain i； PDBConstruct 1–492； UniProt 1–492 Author chain j； PDBConstruct 1–492； UniProt 1–492 Author chain q； PDBConstruct 1–492； UniProt 1–492 Author chain r； PDBConstruct 1–492； UniProt 1–492

Dynein light chain roadblock-type 1

Homo sapiens

UniProt Q9NP97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1 × 1 （A0JNT9） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SKF9） ;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ; × 4 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 4 （O43237） BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin Subunit 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DLRB1_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain k； PDBConstruct 1–96； UniProt 1–96 Author chain l； PDBConstruct 1–96； UniProt 1–96 Author chain s； PDBConstruct 1–96； UniProt 1–96 Author chain t； PDBConstruct 1–96； UniProt 1–96

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6f1t
Deposition date deposition_date	2017-11-23
Structure title title	Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1
Keywords keywords	Cryo-EM, Complex, MOTOR PROTEIN, dynein/dynactin/BICDR, TDR; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6f1t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6f1t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6f1t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	118.70 Å
Total Rg	117.60 Å
Atom count	92795
Residues	13987
Excluded volume	1598600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6f1t__assembly_1__model_1`	45-meric （45）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (26)

Entity 1 Entity 1 polymer

Description description	ARP1 actin related protein 1 homolog A
Molecular weight formula_weight	42670.7 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,I
Atom count atom_count	92795

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 2 Entity 2 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 3 Entity 3 polymer

Description description	Actin related protein 10 homolog
Molecular weight formula_weight	43203.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSL

Entity 4 Entity 4 polymer

Description description	Capping protein (Actin filament) muscle Z-line, alpha 1
Molecular weight formula_weight	33059.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSWRESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Entity 5 Entity 5 polymer

Description description	F-actin capping protein beta subunit
Molecular weight formula_weight	30669.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Entity 6 Entity 6 polymer

Description description	Dynactin Subunit 2
Molecular weight formula_weight	50144.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 7 Entity 7 polymer

Description description	Dynactin Subunit 2
Molecular weight formula_weight	52613.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

Entity 8 Entity 8 polymer

Description description	Dynactin Subunit 3
Molecular weight formula_weight	5549.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 9 Entity 9 polymer

Description description	Dynactin Subunit 2
Molecular weight formula_weight	7422.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	Dynactin 6
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 11 Entity 11 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	20150.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 12 Entity 12 polymer

Description description	BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1
Molecular weight formula_weight	42423.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSAFCLGLAGRASAPAEPDSACCMELPAGAGDAVRSPATAAALVSFPGGPGELELALEEELALLAAGERSSEPGEHPQAEPESPVEGHGPPLPPPPTQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTDKLEHLEQEKHELRRRFENREGEWEGRVSELETDVKQLQDELERQQLHLREADREKTRAVQELSEQNQRLLDQLSRASEVERQLSMQVHALKEDFREKNSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQGHDKDLQLHQSQLELQEVRLSYRQLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 13 Entity 13 polymer

Description description	Dynactin Subunit 4
Molecular weight formula_weight	22400.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

Entity 14 Entity 14 polymer

Description description	Dynactin Subunit 1
Molecular weight formula_weight	4443.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 15 Entity 15 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	7377.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDALLEELTSTSVEHIIVNPNAAYDKFKDKRVGT

Entity 16 Entity 16 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	10000.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDALLEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYE

Entity 17 Entity 17 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	5582.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDALQEELTSTSVEHIIV

Entity 18 Entity 18 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	2880.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MADPKYADLPGIARNEPDVYETSDLP

Entity 19 Entity 19 polymer

Description description	;Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1,Dynein Heavy Chain,Cytoplasmic dynein 1 heavy chain 1,Cytoplasmic dynein 1 heavy chain 1 ;
Molecular weight formula_weight	119509.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,m,n

MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPMITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEESYSAVMGIVSEVEQYVKV

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 20 Entity 20 polymer

Description description	Cytoplasmic dynein 1 intermediate chain 2
Molecular weight formula_weight	68442.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,o,p

MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREAEALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWSTKNNKPLYSFEDNAGYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 21 Entity 21 polymer

Description description	Cytoplasmic dynein 1 light intermediate chain 2
Molecular weight formula_weight	54173.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,j,q,r

MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 22 Entity 22 polymer

Description description	Dynein light chain roadblock-type 1
Molecular weight formula_weight	10934.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,l,s,t

MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 23 Entity 23 polymer

Description description	BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1
Molecular weight formula_weight	42678.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 24 Entity 24 polymer

Description description	Dynactin Subunit 1
Molecular weight formula_weight	4528.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 25 Entity 25 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 26 Entity 26 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 37 domains

CATH v4.4 (37 domains)

Domain ID domain_id	6f1tA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tA03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tB03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tC02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tC03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tD03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tE03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tF01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tF02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tF03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tG02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tG03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tH01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tH02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tH03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tI01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tI02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1tI03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1tK01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	6f1tK02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	6f1tL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	6f1tL02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	6f1tU00
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	10 — Hexapeptide repeat proteins

Domain ID domain_id	6f1tV00
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	10 — Hexapeptide repeat proteins

Domain ID domain_id	6f1tk00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	450 — Beta-Lactamase
Homologous superfamily homologous superfamily	30 — Dynein light chain 2a, cytoplasmic

Domain ID domain_id	6f1tl00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	450 — Beta-Lactamase
Homologous superfamily homologous superfamily	30 — Dynein light chain 2a, cytoplasmic

Domain ID domain_id	6f1ts00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	450 — Beta-Lactamase
Homologous superfamily homologous superfamily	30 — Dynein light chain 2a, cytoplasmic

Domain ID domain_id	6f1tt00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	450 — Beta-Lactamase
Homologous superfamily homologous superfamily	30 — Dynein light chain 2a, cytoplasmic

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	205611

Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARP1 actin related protein 1 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin related protein 10 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capping protein (Actin filament) muscle Z-line, alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin capping protein beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICD family-like cargo adapter 1,BICDR-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers