5nw4

Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Arp1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain H； PDBConstruct 1–376； UniProt 1–376 Author chain O； PDBConstruct 1–376； UniProt 1–376 Author chain P； PDBConstruct 1–376； UniProt 1–376 Author chain Q； PDBConstruct 1–376； UniProt 1–376 Author chain T； PDBConstruct 1–376； UniProt 1–376 Author chain U； PDBConstruct 1–376； UniProt 1–376 Author chain W； PDBConstruct 1–376； UniProt 1–376

beta-actin

OrganismNot specified

UniProt I3LVD5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LVD5_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain V； PDBConstruct 24–396； UniProt 3–375

Arp11

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LHK5_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain X； PDBConstruct 1–417； UniProt 1–417

Capping protein (Actin filament) muscle Z-line, alpha 1

OrganismNot specified

UniProt A0PFK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0PFK5_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Y； PDBConstruct 1–286； UniProt 1–286

F-actin capping protein beta subunit variant II

OrganismNot specified

UniProt D2JYW4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2JYW4_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Z； PDBConstruct 18–293； UniProt 2–277

Dynactin 6

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0G6S1_PIG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain g； PDBConstruct 1–190； UniProt 1–190

Dynactin

OrganismNot specified

UniProt A0A0J9X292

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0J9X292_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain k； PDBConstruct 1–48； UniProt 1–48

Dynactin

OrganismNot specified

UniProt A0A0J9X293

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0J9X293_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain l； PDBConstruct 1–71； UniProt 1–71

Dynactin

OrganismNot specified

UniProt A0A0J9X299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0J9X299_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain m； PDBConstruct 1–31； UniProt 1–31

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5nw4
Deposition date deposition_date	2017-05-05
Structure title title	Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2
Keywords keywords	Motor protein, dynein, dynactin, BICD; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5nw4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5nw4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5nw4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	109.40 Å
Total Rg	108.70 Å
Atom count	66272
Residues	10707
Excluded volume	1132700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5nw4__assembly_1__model_1`	39-meric （39）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (28)

Entity 1 Entity 1 polymer

Description description	dynein heavy chain
Molecular weight formula_weight	75675.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	66297

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	dynein intermediate chain
Molecular weight formula_weight	29038.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	dynein intermediate chain
Molecular weight formula_weight	29804.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	dynein heavy chain
Molecular weight formula_weight	78484.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	dynein N-terminal dimerization domain
Molecular weight formula_weight	10656.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	dynein N-terminal dimerization domain
Molecular weight formula_weight	10571.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 7 Entity 7 polymer

Description description	Robl
Molecular weight formula_weight	10230.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 8 Entity 8 polymer

Description description	dynein light intermediate chain
Molecular weight formula_weight	25123.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 9 Entity 9 polymer

Description description	dynein light intermediate chain
Molecular weight formula_weight	25379.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 10 Entity 10 polymer

Description description	Arp1
Molecular weight formula_weight	42684.7 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,O,P,Q,T,U,W

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 11 Entity 11 polymer

Description description	beta-actin
Molecular weight formula_weight	43987.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MSVRSARRASASAEAELLQTMGDEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 12 Entity 12 polymer

Description description	Arp11
Molecular weight formula_weight	46250.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Entity 13 Entity 13 polymer

Description description	Capping protein (Actin filament) muscle Z-line, alpha 1
Molecular weight formula_weight	33059.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSWRESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Entity 14 Entity 14 polymer

Description description	F-actin capping protein beta subunit variant II
Molecular weight formula_weight	33060.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MDTELASPGPLLLGKYRSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQIHIQPDN

Entity 15 Entity 15 polymer

Description description	dynactin shoulder complex
Molecular weight formula_weight	48613.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

Entity 16 Entity 16 polymer

Description description	dynactin shoulder complex
Molecular weight formula_weight	51251.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

Entity 17 Entity 17 polymer

Description description	dynactin shoulder complex
Molecular weight formula_weight	11081.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,d

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 18 Entity 18 polymer

Description description	dynactin shoulder complex
Molecular weight formula_weight	14826.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 19 Entity 19 polymer

Description description	Dynactin 6
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 20 Entity 20 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	24538.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MREEEAESGSRGAAGSVWNRILTDRLTGFDRNGSCEELVTMELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 21 Entity 21 polymer

Description description	dynactin pointed end p62
Molecular weight formula_weight	20698.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

Entity 22 Entity 22 polymer

Description description	p150
Molecular weight formula_weight	4443.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 23 Entity 23 polymer

Description description	Dynactin
Molecular weight formula_weight	5400.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MADPKYADLPGIARNEPDVYLEELTSTSVEHAIVNPNAAYDKFKDKRV

Entity 24 Entity 24 polymer

Description description	Dynactin
Molecular weight formula_weight	7931.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MADPKYADLPGIARNEPDVYLEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGE

Entity 25 Entity 25 polymer

Description description	Dynactin
Molecular weight formula_weight	3019.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MADPKYADLPGIARNEPDVYAAAAAAAAAAA

Entity 26 Entity 26 polymer

Description description	Dynactin
Molecular weight formula_weight	2237.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MADPKYADLPGIARNEPDVY

Entity 27 Entity 27 polymer

Description description	dynactin p150
Molecular weight formula_weight	4528.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 28 Entity 28 polymer

Description description	BICD2N
Molecular weight formula_weight	23421.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

▶

Resolution resolution	8.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	78671

Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Arp1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

beta-actin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Arp11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capping protein (Actin filament) muscle Z-line, alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin capping protein beta subunit variant II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5nw4__assembly_1__model_1

5nw4__assembly_1__model_1 | I(q)

5nw4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment