5nw4

Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2

Method: ELECTRON MICROSCOPY D_max: 298.9 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Arp1

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain G； UniProt 1–376 Chain H； UniProt 1–376 Chain O； UniProt 1–376 Chain P； UniProt 1–376 Chain Q； UniProt 1–376 Chain T； UniProt 1–376 Chain U； UniProt 1–376 Chain W； UniProt 1–376	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5NW4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ADX CryoEM structure of dynactin complex at 4.0 angstrom resolution Deposited 2015-08-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain A 7–376（370 aa） Chain B 7–376（370 aa） Chain C 7–376（370 aa） Chain D 7–376（370 aa） Chain E 7–376（370 aa） Chain F 7–376（370 aa） Chain G 7–376（370 aa） Chain I 7–376（370 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain A 7–376（370 aa） Chain B 7–376（370 aa） Chain C 7–376（370 aa） Chain D 7–376（370 aa） Chain E 7–376（370 aa） Chain F 7–376（370 aa） Chain G 7–376（370 aa） Chain I 7–376（370 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F1U N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1 Deposited 2017-11-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain B 1–376（376 aa） Chain D 1–376（376 aa） Chain F 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6ZNM The pointed end complex of dynactin bound to BICDR1 Deposited 2020-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6ZNN The pointed end complex of dynactin bound to Hook3 Deposited 2020-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6ZNO The pointed end complex of dynactin with the p150 projection docked Deposited 2020-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
6ZO4 The pointed end complex of dynactin bound to BICD2 Deposited 2020-07-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8I The barbed end complex of dynactin bound to BICDR1 and the cytoplasmic dynein tails (A2, B1, B2) Deposited 2022-03-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.30 Å
7Z8K Cytoplasmic dynein (A1) bound to BICDR1 Deposited 2022-03-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–376（376 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 4.37 Å
7Z8M The pointed end complex of dynactin bound to BICDR1 Deposited 2022-03-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ZN ZINC ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.37 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å

17 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain H； PDBConstruct 1–376； UniProt 1–376 Author chain O； PDBConstruct 1–376； UniProt 1–376 Author chain P； PDBConstruct 1–376； UniProt 1–376 Author chain Q； PDBConstruct 1–376； UniProt 1–376 Author chain T； PDBConstruct 1–376； UniProt 1–376 Author chain U； PDBConstruct 1–376； UniProt 1–376 Author chain W； PDBConstruct 1–376； UniProt 1–376

beta-actin

OrganismNot specified

UniProt I3LVD5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain V； UniProt 3–375	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	I3LVD5_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain V； PDBConstruct 24–396； UniProt 3–375

Arp11

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain X； UniProt 1–417	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5NW4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ADX CryoEM structure of dynactin complex at 4.0 angstrom resolution Deposited 2015-08-24	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain J 1–417（417 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain J 12–390（379 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 1–390（390 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 1–390（390 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain J 1–390（390 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6ZNM The pointed end complex of dynactin bound to BICDR1 Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6ZNN The pointed end complex of dynactin bound to Hook3 Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6ZNO The pointed end complex of dynactin with the p150 projection docked Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
6ZO4 The pointed end complex of dynactin bound to BICD2 Deposited 2020-07-07	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8M The pointed end complex of dynactin bound to BICDR1 Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain J 1–417（417 aa）	Not recorded	ZN ZINC ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.37 Å
8PR4 Dynactin pointed end bound to JIP3 Deposited 2023-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain J 1–417（417 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9DGR Composite structure of dynein-dynactin on microtubules Deposited 2024-09-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain J 1–417（417 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.00 Å
9DGS Dynactin and dynein tail region of dynein-dynactin complex on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9DGT structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.20 Å
9DGU structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
9DGV structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.80 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å
9YNG Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the presence of LIS1 Deposited 2025-10-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LHK5_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain X； PDBConstruct 1–417； UniProt 1–417

Capping protein (Actin filament) muscle Z-line, alpha 1

OrganismNot specified

UniProt A0PFK5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain Y； UniProt 1–286	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5NW4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ADX CryoEM structure of dynactin complex at 4.0 angstrom resolution Deposited 2015-08-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain K 7–281（275 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain K 7–281（275 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F1U N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1 Deposited 2017-11-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8I The barbed end complex of dynactin bound to BICDR1 and the cytoplasmic dynein tails (A2, B1, B2) Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.30 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9DGR Composite structure of dynein-dynactin on microtubules Deposited 2024-09-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain K 1–286（286 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.00 Å
9DGS Dynactin and dynein tail region of dynein-dynactin complex on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9DGT structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.20 Å
9DGU structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
9DGV structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.80 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å
9YNG Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the presence of LIS1 Deposited 2025-10-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å

17 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0PFK5_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Y； PDBConstruct 1–286； UniProt 1–286

F-actin capping protein beta subunit variant II

OrganismNot specified

UniProt D2JYW4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain Z； UniProt 2–277	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5NW4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ADX CryoEM structure of dynactin complex at 4.0 angstrom resolution Deposited 2015-08-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain L 2–271（270 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain L 2–271（270 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	D2JYW4_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Z； PDBConstruct 18–293； UniProt 2–277

Dynactin 6

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain g； UniProt 1–190	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5NW4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ADX CryoEM structure of dynactin complex at 4.0 angstrom resolution Deposited 2015-08-24	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 1–190（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6ZNM The pointed end complex of dynactin bound to BICDR1 Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6ZNN The pointed end complex of dynactin bound to Hook3 Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6ZNO The pointed end complex of dynactin with the p150 projection docked Deposited 2020-07-06	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain U 8–174（167 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
6ZO4 The pointed end complex of dynactin bound to BICD2 Deposited 2020-07-07	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8M The pointed end complex of dynactin bound to BICDR1 Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain U 1–190（190 aa）	Not recorded	ZN ZINC ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.37 Å
8PR4 Dynactin pointed end bound to JIP3 Deposited 2023-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain U 1–190（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9DGR Composite structure of dynein-dynactin on microtubules Deposited 2024-09-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain U 1–190（190 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.00 Å
9DGS Dynactin and dynein tail region of dynein-dynactin complex on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9DGT structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.20 Å
9DGU structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
9DGV structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.80 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å
9YNG Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the presence of LIS1 Deposited 2025-10-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å

20 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	D0G6S1_PIG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain g； PDBConstruct 1–190； UniProt 1–190

Dynactin

OrganismNot specified

UniProt A0A0J9X292

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain k； UniProt 1–48	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X293） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0J9X292_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain k； PDBConstruct 1–48； UniProt 1–48

Dynactin

OrganismNot specified

UniProt A0A0J9X293

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain l； UniProt 1–71	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X299） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0J9X293_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain l； PDBConstruct 1–71； UniProt 1–71

Dynactin

OrganismNot specified

UniProt A0A0J9X299

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 39 PDB declaration: 39-meric（39） Consistent with protein copy count	Chain m； UniProt 1–31	Not recorded	dynein heavy chain × 1 dynein intermediate chain × 1 dynein intermediate chain × 1 dynein heavy chain × 1 dynein N-terminal dimerization domain × 1 dynein N-terminal dimerization domain × 1 Robl × 2 dynein light intermediate chain × 1 dynein light intermediate chain × 1 Arp1 × 8 （F2Z5G5） beta-actin × 1 （I3LVD5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit variant II × 1 （D2JYW4） dynactin shoulder complex × 1 dynactin shoulder complex × 1 dynactin shoulder complex × 2 dynactin shoulder complex × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 dynactin pointed end p62 × 1 p150 × 1 Dynactin × 1 （A0A0J9X292） Dynactin × 1 （A0A0J9X293） Dynactin × 1 dynactin p150 × 1 BICD2N × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0J9X299_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain m； PDBConstruct 1–31； UniProt 1–31

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5nw4
Deposition date deposition_date	2017-05-05
Structure title title	Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2
Keywords keywords	Motor protein, dynein, dynactin, BICD; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	109.40 Å
Forward intensity I(0) i0	14255300000.00
Molecular weight molecular_weight	934540.0 kDa
Excluded volume excluded_volume	1132700 Å³
Envelope volume envelope_volume	2718700 Å³
Hydration-shell volume shell_volume	227530 Å³
Envelope diameter envelope_diameter	452.1 Å
Shell Rg shell_rg	86.78 Å
Envelope Rg envelope_rg	111.70 Å
Shape Rg shape_rg	109.60 Å
Total Rg total_rg	108.70 Å
Total atoms total_atoms	66272
Residues n_residues	10707
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	298.9 Å
Rg (real space) rg_real	101.60 Å
Rg uncertainty (real space) rg_real_error	1.43 Å
I(0) (real space) i0_real	1.3620e+10
I(0) uncertainty (real space) i0_real_error	2.9630e+08
Rg (reciprocal space) rg_reciprocal	99.83 Å
I(0) (reciprocal space) i0_reciprocal	13840000000.0000
Solution quality estimate total_estimate	0.9174
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	106.8 Å
Skewness Skewness skewness	0.354
Kurtosis Kurtosis kurtosis	-0.528
Angular range angular_range	— – 0.0700 Å⁻¹
Current regularization parameter α current_alpha	0.7134
Highest regularization parameter α highest_alpha	480600000.0000
Real-space data points n_real_points	15
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.022; Oscil: 0.998; Stabil: 0.980; Sysdev: 1.000; Positv: 1.000; Valcen: 0.989; Smooth: 0.003

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (28)

Entity 1 Entity 1 polymer

Description description	dynein heavy chain
Molecular weight formula_weight	75675.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	66297

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	dynein intermediate chain
Molecular weight formula_weight	29038.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	dynein intermediate chain
Molecular weight formula_weight	29804.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	dynein heavy chain
Molecular weight formula_weight	78484.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	dynein N-terminal dimerization domain
Molecular weight formula_weight	10656.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	dynein N-terminal dimerization domain
Molecular weight formula_weight	10571.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 7 Entity 7 polymer

Description description	Robl
Molecular weight formula_weight	10230.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 8 Entity 8 polymer

Description description	dynein light intermediate chain
Molecular weight formula_weight	25123.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 9 Entity 9 polymer

Description description	dynein light intermediate chain
Molecular weight formula_weight	25379.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 10 Entity 10 polymer

Description description	Arp1
Molecular weight formula_weight	42684.7 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,O,P,Q,T,U,W

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 11 Entity 11 polymer

Description description	beta-actin
Molecular weight formula_weight	43987.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MSVRSARRASASAEAELLQTMGDEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 12 Entity 12 polymer

Description description	Arp11
Molecular weight formula_weight	46250.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Entity 13 Entity 13 polymer

Description description	Capping protein (Actin filament) muscle Z-line, alpha 1
Molecular weight formula_weight	33059.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSWRESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Entity 14 Entity 14 polymer

Description description	F-actin capping protein beta subunit variant II
Molecular weight formula_weight	33060.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MDTELASPGPLLLGKYRSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQIHIQPDN

Entity 15 Entity 15 polymer

Description description	dynactin shoulder complex
Molecular weight formula_weight	48613.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

Entity 16 Entity 16 polymer

Description description	dynactin shoulder complex
Molecular weight formula_weight	51251.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

Entity 17 Entity 17 polymer

Description description	dynactin shoulder complex
Molecular weight formula_weight	11081.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,d

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 18 Entity 18 polymer

Description description	dynactin shoulder complex
Molecular weight formula_weight	14826.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 19 Entity 19 polymer

Description description	Dynactin 6
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 20 Entity 20 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	24538.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MREEEAESGSRGAAGSVWNRILTDRLTGFDRNGSCEELVTMELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 21 Entity 21 polymer

Description description	dynactin pointed end p62
Molecular weight formula_weight	20698.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

Entity 22 Entity 22 polymer

Description description	p150
Molecular weight formula_weight	4443.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 23 Entity 23 polymer

Description description	Dynactin
Molecular weight formula_weight	5400.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MADPKYADLPGIARNEPDVYLEELTSTSVEHAIVNPNAAYDKFKDKRV

Entity 24 Entity 24 polymer

Description description	Dynactin
Molecular weight formula_weight	7931.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MADPKYADLPGIARNEPDVYLEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGE

Entity 25 Entity 25 polymer

Description description	Dynactin
Molecular weight formula_weight	3019.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MADPKYADLPGIARNEPDVYAAAAAAAAAAA

Entity 26 Entity 26 polymer

Description description	Dynactin
Molecular weight formula_weight	2237.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MADPKYADLPGIARNEPDVY

Entity 27 Entity 27 polymer

Description description	dynactin p150
Molecular weight formula_weight	4528.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 28 Entity 28 polymer

Description description	BICD2N
Molecular weight formula_weight	23421.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

▶

8. Citations (1)

▶

Resolution resolution	8.70 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	78671

fit	/app/data/saxs_computation/nw/5nw4/5nw4.fit
pddf	/app/data/pr_computation/nw/5nw4/5nw4.pr.out
profile	/app/data/saxs_computation/nw/5nw4/5nw4.dat

Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Arp1

State in the Current Structure

Other States of the Same Protein in the Database

beta-actin

State in the Current Structure

Other States of the Same Protein in the Database

Arp11

State in the Current Structure

Other States of the Same Protein in the Database

Capping protein (Actin filament) muscle Z-line, alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

F-actin capping protein beta subunit variant II

State in the Current Structure

Other States of the Same Protein in the Database

Dynactin 6

State in the Current Structure

Other States of the Same Protein in the Database

Dynactin

State in the Current Structure

Other States of the Same Protein in the Database

Dynactin

State in the Current Structure

Other States of the Same Protein in the Database

Dynactin

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (28)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

Entity 7 Entity 7 polymer

Polymer Polymer

来源 Source

Entity 8 Entity 8 polymer

Polymer Polymer

来源 Source

Entity 9 Entity 9 polymer

Polymer Polymer

来源 Source

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

Entity 15 Entity 15 polymer

Polymer Polymer

Entity 16 Entity 16 polymer

Polymer Polymer

Entity 17 Entity 17 polymer

Polymer Polymer