9hhl

Structure of Dynein-Dynactin-NuMA-LIS1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytoplasmic dynein 1 intermediate chain 2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DC1I2_HUMAN
Isoform	Q13409-3
PDB entities	1
Chains and sequence ranges	Author chain g； PDBConstruct 1–612； UniProt 1–612 Author chain h； PDBConstruct 1–612； UniProt 1–612 Author chain o； PDBConstruct 1–612； UniProt 1–612 Author chain p； PDBConstruct 1–612； UniProt 1–612

Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase

Homo sapiens

UniProt P16455

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MGMT_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 708–889； UniProt 1–182 Author chain 2； PDBConstruct 708–889； UniProt 1–182

Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase

Homo sapiens

UniProt Q14980

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUMA1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–705； UniProt 1–705 Author chain 2； PDBConstruct 1–705； UniProt 1–705

ARP1 actin related protein 1 homolog A

OrganismNot specified

UniProt F2Z5G5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–376； UniProt 1–376 Author chain B； PDBConstruct 1–376； UniProt 1–376 Author chain C； PDBConstruct 1–376； UniProt 1–376 Author chain D； PDBConstruct 1–376； UniProt 1–376 Author chain E； PDBConstruct 1–376； UniProt 1–376 Author chain F； PDBConstruct 1–376； UniProt 1–376 Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain I； PDBConstruct 1–376； UniProt 1–376

Actin, cytoplasmic 1

OrganismNot specified

UniProt Q6QAQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–375； UniProt 1–375

Arp11

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LHK5_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain J； PDBConstruct 1–417； UniProt 1–417

Capping protein (Actin filament) muscle Z-line, alpha 1

OrganismNot specified

UniProt A0PFK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0PFK5_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain K； PDBConstruct 1–286； UniProt 1–286

F-actin-capping protein subunit beta

OrganismNot specified

UniProt A0PFK7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPZB_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain L； PDBConstruct 1–272； UniProt 1–272

Dynactin subunit 2

OrganismNot specified

UniProt A0A5G2QD80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2QD80_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain M； PDBConstruct 1–405； UniProt 1–405 Author chain N； PDBConstruct 1–405； UniProt 1–405 Author chain P； PDBConstruct 1–405； UniProt 1–405 Author chain Q； PDBConstruct 1–405； UniProt 1–405 Author chain V； PDBConstruct 1–405； UniProt 1–405

Dynactin subunit 3

OrganismNot specified

UniProt F1SEC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SEC0_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain O； PDBConstruct 1–186； UniProt 1–186 Author chain R； PDBConstruct 1–186； UniProt 1–186

Dynactin 6

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0G6S1_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–190； UniProt 1–190

Dynactin subunit 5

OrganismNot specified

UniProt A0A286ZK88

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZK88_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain W； PDBConstruct 1–182； UniProt 1–182

Dynactin subunit 4

OrganismNot specified

UniProt A0A4X1TB62

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TB62_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Y； PDBConstruct 1–467； UniProt 1–467

Cytoplasmic dynein 1 heavy chain 1

Homo sapiens

UniProt Q14204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DYHC1_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain e； PDBConstruct 1–4646； UniProt 1–4646 Author chain f； PDBConstruct 1–4646； UniProt 1–4646 Author chain m； PDBConstruct 1–4646； UniProt 1–4646 Author chain n； PDBConstruct 1–4646； UniProt 1–4646

Cytoplasmic dynein 1 light intermediate chain 2

Homo sapiens

UniProt O43237

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Dynein light chain roadblock-type 1 × 4 （Q9NP97） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DC1L2_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain j； PDBConstruct 1–492； UniProt 1–492 Author chain q； PDBConstruct 1–492； UniProt 1–492 Author chain u； PDBConstruct 1–492； UniProt 1–492

Dynein light chain roadblock-type 1

Homo sapiens

UniProt Q9NP97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynactin subunit 1 × 2 （A0A287B8J2） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DLRB1_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain s； PDBConstruct 1–96； UniProt 1–96 Author chain t； PDBConstruct 1–96； UniProt 1–96 Author chain w； PDBConstruct 1–96； UniProt 1–96 Author chain z； PDBConstruct 1–96； UniProt 1–96

Dynactin subunit 1

OrganismNot specified

UniProt A0A287B8J2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 41	Cytoplasmic dynein 1 intermediate chain 2 × 4 （Q13409） Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase × 2 （P16455,Q14980） ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 5 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 3 （O43237） Dynein light chain roadblock-type 1 × 4 （Q9NP97） ADENOSINE-5'-DIPHOSPHATE × 8 ADENOSINE-5'-TRIPHOSPHATE × 2 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN1_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain S； PDBConstruct 1–1281； UniProt 1–1281 Author chain T； PDBConstruct 1–1281； UniProt 1–1281

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hhl
Deposition date deposition_date	2024-11-21
Structure title title	Structure of Dynein-Dynactin-NuMA-LIS1
Keywords keywords	motor protein, transport; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9hhl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9hhl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9hhl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	114.80 Å
Total Rg	114.60 Å
Atom count	64583
Residues	12994
Excluded volume	1039400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9hhl__assembly_1__model_1`	41-meric （41）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	Cytoplasmic dynein 1 intermediate chain 2
Molecular weight formula_weight	68442.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p,g,h,o
Atom count atom_count	64583

MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREAEALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWSTKNNKPLYSFEDNAGYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase
Molecular weight formula_weight	99677.2 kDa
EC 编号 ec_number	2.1.1.63
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2

MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQAQLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQEAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQAKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQQQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERDAALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVETARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQLQEQLQGSMDKDCEMKRTTLDSPLGKLELSGCEQGLHRIIFLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKPGLG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	ARP1 actin related protein 1 homolog A
Molecular weight formula_weight	42670.7 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,E,F,G,I,C

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 4 Entity 4 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 5 Entity 5 polymer

Description description	Arp11
Molecular weight formula_weight	46250.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Entity 6 Entity 6 polymer

Description description	Capping protein (Actin filament) muscle Z-line, alpha 1
Molecular weight formula_weight	33059.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSWRESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Entity 7 Entity 7 polymer

Description description	F-actin-capping protein subunit beta
Molecular weight formula_weight	30669.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Entity 8 Entity 8 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	44704.4 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,P,Q,V

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAELEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKMTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNTKGAGSGGKTTSGSPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIACSLKDNATLLTQVQTTMRENLSTVEGNFANIDERMKKLGK

Entity 9 Entity 9 polymer

Description description	Dynactin subunit 3
Molecular weight formula_weight	21192.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,R

MAGVTDVQRLQARLEELERWVYGPGGSRGSRKVADGLVKVQVALGNIASKRERVKILYKKIEDLIKYLDPEYMDRIAIPDASKLQFILAEEQFILSQVALLEQVEALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAAKQVKPAEE

Entity 10 Entity 10 polymer

Description description	Dynactin 6
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 11 Entity 11 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	20150.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 12 Entity 12 polymer

Description description	Dynactin subunit 4
Molecular weight formula_weight	52920.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPSAEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTAVKKAYYLACGFCRWTSRDVGMADKSVASGGWQEPDHPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQHTIHVVDKYGLGTRLQRPRAGTTITALAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRQCEHNLSKPEFNPTSIKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEEGDPDDTNSTAKVSVPPTELVLAGKDAAAEYDELAEPQDFPDDPDVVAFRKANKVGVFIKVTPQREEGDVTVCFKLKHDFKNLAAPIRPVEEADPGAEVSWLTQHVELSLGPLLP

Entity 13 Entity 13 polymer

Description description	Cytoplasmic dynein 1 heavy chain 1
Molecular weight formula_weight	533055.1 kDa
Mutation mutation	R1567E, K1610E
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,m,n

MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPMITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYRNALTRMPDGPVALEESYSAVMGIVSEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQRFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTDWEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQVALEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDALLNQLKSFPARLRQYASYEFVQRLLKGYMKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKNEAIVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKVKEHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHLLPVETQEFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGEIQKALGEYLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDNSVVLGISSREGEEVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYITWIDKYQAQLVVLSAQIAWSENVETALSSMGGGGDAAPLHSVLSNVEVTLNVLADSVLMEQPPLRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQCIQEALREHSNPNYDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSAGNVKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINHGLMMVGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDGLFTHVLRKIIDSVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRIMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRRKGKEDEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFQLEHIMDLTRLRCLGSLFSMLHQACRNVAQYNANHPDFPMQIEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYIRRITTVPLPTAPNIPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVRHEALLYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRRTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPVEGLIRIWAHEALRLFQDRLVEDEERRWTDENIDTVALKHFPNIDREKAMSRPILYSNWLSKDYIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESNVLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNYIVPDYMPVVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLDFINHYANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQFRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEVTRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLYQYSLQFFLDIYHNVLYENPNLKGVTDHTQRLSIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTVGEPTYDAEFQHFLRGNEIVLSAGSTPRIQGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFGIWLDSSSPEQTVPYLWSEETPATPIGQAIHRLLLIQAFRPDRLLAMAHMFVSTNLGESFMSIMEQPLDLTHIVGTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGFNQADKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLRAGRIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLAWFHAIIQERLRYAPLGWSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVDNEFDQRLLNTFLERLFTTRSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDTQTPSWLGLPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTSQGATLDACSFGVTGLKLQGATCNNNKLSLSNAISTALPLTQLRWVKQTNTEKKASVVTLPVYLNFTRADLIFTVDFEIATKEDPRSFYERGVAVLCTE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 14 Entity 14 polymer

Description description	Cytoplasmic dynein 1 light intermediate chain 2
Molecular weight formula_weight	54173.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,q,u

MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 15 Entity 15 polymer

Description description	Dynein light chain roadblock-type 1
Molecular weight formula_weight	10934.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s,t,w,z

MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 16 Entity 16 polymer

Description description	Dynactin subunit 1
Molecular weight formula_weight	142015.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T

MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLRREGTDSNAKTSKLRGPKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEASDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGAQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGIRGPPPSGIATLVSGIAGEEQQRGGAPGQAPGIVPGPGLVKDSPLLLQQISAMRLHISQLQHENSVLKGAQMKASLAALPPLHVAKLSLPPHEGPGSELAAGALYRKTNQLLETLNQLSTHTHVVDITRSSPAAKSPSAQLLEQVTQLKSLSDTIEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGLGQRHRLVLTQEQLHQLHDRLIS

Entity 17 Entity 17 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 18 Entity 18 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.53 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	8092

Structure of Dynein-Dynactin-NuMA-LIS1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytoplasmic dynein 1 intermediate chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear mitotic apparatus protein 1,Methylated-DNA--protein-cysteine methyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ARP1 actin related protein 1 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Arp11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capping protein (Actin filament) muscle Z-line, alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin-capping protein subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer