6qw6

Structure of the human U5.U4/U6 tri-snRNP at 2.9A resolution.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR27_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain X； PDBConstruct 1–155； UniProt 1–155

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 41； PDBConstruct 1–119； UniProt 1–119 Author chain 51； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 42； PDBConstruct 1–118； UniProt 1–118 Author chain 52； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 43； PDBConstruct 1–126； UniProt 1–126 Author chain 53； PDBConstruct 1–126； UniProt 1–126

U4/U6 small nuclear ribonucleoprotein Prp3

OrganismNot specified

UniProt O43395

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRPF3_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 4A； PDBConstruct 1–683； UniProt 1–683

U4/U6 small nuclear ribonucleoprotein Prp4

OrganismNot specified

UniProt O43172

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 4B； PDBConstruct 1–522； UniProt 1–522

U4/U6 small nuclear ribonucleoprotein Prp31

OrganismNot specified

UniProt Q8WWY3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 4C； PDBConstruct 1–499； UniProt 1–499

NHP2-like protein 1

OrganismNot specified

UniProt P55769

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NH2L1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 4D； PDBConstruct 1–128； UniProt 1–128

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 4b； PDBConstruct 1–240； UniProt 1–240 Author chain 5b； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 4e； PDBConstruct 1–92； UniProt 1–92 Author chain 5e； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 4f； PDBConstruct 1–86； UniProt 1–86 Author chain 5f； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 4g； PDBConstruct 1–76； UniProt 1–76 Author chain 5g； PDBConstruct 1–76； UniProt 1–76

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 5A； PDBConstruct 1–2311； UniProt 25–2335

U5 small nuclear ribonucleoprotein 200 kDa helicase

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 5B； PDBConstruct 1–2136； UniProt 1–2136

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 5C； PDBConstruct 1–853； UniProt 104–956

Thioredoxin-like protein 4A

OrganismNot specified

UniProt P83876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXN4A_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 5D； PDBConstruct 1–142； UniProt 1–142

Pre-mRNA-processing factor 6

OrganismNot specified

UniProt O94906

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP6_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 5J； PDBConstruct 1–941； UniProt 1–941

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 5O； PDBConstruct 1–357； UniProt 1–357

Probable ATP-dependent RNA helicase DDX23

Homo sapiens

UniProt Q9BUQ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DDX23_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 5X； PDBConstruct 1–820； UniProt 1–820

U6 snRNA-associated Sm-like protein LSm2

OrganismNot specified

UniProt Q9Y333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 62； PDBConstruct 1–95； UniProt 1–95

U6 snRNA-associated Sm-like protein LSm3

OrganismNot specified

UniProt P62310

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 63； PDBConstruct 1–102； UniProt 1–102

U6 snRNA-associated Sm-like protein LSm4

OrganismNot specified

UniProt Q9Y4Z0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain 64； PDBConstruct 1–139； UniProt 1–139

U6 snRNA-associated Sm-like protein LSm5

OrganismNot specified

UniProt Q9Y4Y9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 65； PDBConstruct 1–91； UniProt 1–91

U6 snRNA-associated Sm-like protein LSm6

OrganismNot specified

UniProt P62312

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 66； PDBConstruct 1–80； UniProt 1–80

U6 snRNA-associated Sm-like protein LSm7

OrganismNot specified

UniProt Q9UK45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 67； PDBConstruct 1–103； UniProt 1–103

U6 snRNA-associated Sm-like protein LSm8

OrganismNot specified

UniProt O95777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 68； PDBConstruct 1–96； UniProt 1–96

RNA-binding protein 42

OrganismNot specified

UniProt Q9BTD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM42_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain R； PDBConstruct 1–480； UniProt 1–480

U4/U6.U5 tri-snRNP-associated protein 1

OrganismNot specified

UniProt O43290

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT1_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain S； PDBConstruct 1–800； UniProt 1–800

U4/U6.U5 tri-snRNP-associated protein 2

OrganismNot specified

UniProt Q53GS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 3	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U4 snRNA × 1 Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT2_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain U； PDBConstruct 1–555； UniProt 1–555

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qw6
Deposition date deposition_date	2019-03-05
Structure title title	Structure of the human U5.U4/U6 tri-snRNP at 2.9A resolution.
Keywords keywords	RNP complex, splicing, RNA, protein, spliceosome; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6qw6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6qw6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6qw6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	86.35 Å
Rg (electron density)	86.03 Å
Total Rg	86.19 Å
Atom count	89181
Residues	10621
Excluded volume	1572700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6qw6__assembly_1__model_1`	39-meric （39）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (36)

Entity 1 Entity 1 polymer

Description description	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein
Molecular weight formula_weight	18915.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X
Atom count atom_count	89236

MGRSRSRSPRRERRRSRSTSRERERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA

Entity 2 Entity 2 polymer

Description description	U4 snRNA
Molecular weight formula_weight	46997.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

XAGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUUUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUACCCCGCCGUGACGACUUGCAAUAUAGUCGGCAUUGGCAAUUUUUGACAGUCUCUACGGAGACUGG

Entity 3 Entity 3 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	41,51

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 4 Entity 4 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	42,52

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 5 Entity 5 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	43,53

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 6 Entity 6 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp3
Molecular weight formula_weight	77669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4A

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

Entity 7 Entity 7 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp4
Molecular weight formula_weight	58536.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4B

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

Entity 8 Entity 8 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp31
Molecular weight formula_weight	55529.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4C

MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Entity 9 Entity 9 polymer

Description description	NHP2-like protein 1
Molecular weight formula_weight	14191.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4D

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Entity 10 Entity 10 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4b,5b

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 11 Entity 11 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4e,5e

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 12 Entity 12 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4f,5f

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 13 Entity 13 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4g,5g

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 14 Entity 14 polymer

Description description	U5 snRNA
Molecular weight formula_weight	37254.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Entity 15 Entity 15 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	271508.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5A

MSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 16 Entity 16 polymer

Description description	U5 small nuclear ribonucleoprotein 200 kDa helicase
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5B

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 17 Entity 17 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	95836.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5C

LMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDP

Entity 18 Entity 18 polymer

Description description	Thioredoxin-like protein 4A
Molecular weight formula_weight	16807.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5D

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Entity 19 Entity 19 polymer

Description description	Pre-mRNA-processing factor 6
Molecular weight formula_weight	107092.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5J

MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF

Entity 20 Entity 20 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5O

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 21 Entity 21 polymer

Description description	Probable ATP-dependent RNA helicase DDX23
Molecular weight formula_weight	95785.1 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5X

MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Saccharomyces cerevisiae

Entity 22 Entity 22 polymer

Description description	U6 snRNA
Molecular weight formula_weight	28342.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUUU

Entity 23 Entity 23 polymer

Description description	U6 snRNA-associated Sm-like protein LSm2
Molecular weight formula_weight	10847.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	62

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Entity 24 Entity 24 polymer

Description description	U6 snRNA-associated Sm-like protein LSm3
Molecular weight formula_weight	11859.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	63

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Entity 25 Entity 25 polymer

Description description	U6 snRNA-associated Sm-like protein LSm4
Molecular weight formula_weight	15375.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	64

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Entity 26 Entity 26 polymer

Description description	U6 snRNA-associated Sm-like protein LSm5
Molecular weight formula_weight	9945.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	65

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Entity 27 Entity 27 polymer

Description description	U6 snRNA-associated Sm-like protein LSm6
Molecular weight formula_weight	9139.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	66

MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

Entity 28 Entity 28 polymer

Description description	U6 snRNA-associated Sm-like protein LSm7
Molecular weight formula_weight	11617.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	67

MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA

Entity 29 Entity 29 polymer

Description description	U6 snRNA-associated Sm-like protein LSm8
Molecular weight formula_weight	10410.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	68

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

Entity 30 Entity 30 polymer

Description description	RNA-binding protein 42
Molecular weight formula_weight	50477.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAGAGPAPGLPGAGGPVVPGPGAGIPGKSGEERLKEMEAEMALFEQEVLGAPVPGIPTAVPAVPTVPTVPTVEAMQVPAAPVIRPIIATNTYQQVQQTLEARAAAAATVVPPMVGGPPFVGPVGFGPGDRSHLDSPEAREAMFLRRAAVAPQRAPILRPAFVPHVLQRADSALSSAAAGPRPMALRPPHQALVGPPLPGPPGPPMMLPPMARAPGPPLGSMAALRPPLEEPAAPRELGLGLGLGLKEKEEAVVAAAAGLEEASAAVAVGAGGAPAGPAVIGPSLPLALAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

Entity 31 Entity 31 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 1
Molecular weight formula_weight	90414.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQKTPYIVLSGSGKSMNANTITK

Entity 32 Entity 32 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 2
Molecular weight formula_weight	64408.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRR

Entity 33 Entity 33 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 34 Entity 34 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 35 Entity 35 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 36 Entity 36 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	2.92 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	585488

Structure of the human U5.U4/U6 tri-snRNP at 2.9A resolution.

1. Protein Identity and Related Structures Protein Identity & Related Structures

U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein Prp3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein Prp4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein Prp31

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NHP2-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer