SAXSdb — 2om1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 12	RESORCINOL × 6 ZINC ION × 2 THIOCYANATE ION × 2 water × 12	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 12	RESORCINOL × 6 ZINC ION × 2 THIOCYANATE ION × 2 GLYCEROL × 1 water × 12	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 12	RESORCINOL × 6 ZINC ION × 2 THIOCYANATE ION × 2 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INS_HUMAN
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–21； UniProt 90–110 Author chain 3； PDBConstruct 1–21； UniProt 90–110 Author chain A； PDBConstruct 1–21； UniProt 90–110 Author chain C； PDBConstruct 1–21； UniProt 90–110 Author chain E； PDBConstruct 1–21； UniProt 90–110 Author chain G； PDBConstruct 1–21； UniProt 90–110 Author chain I； PDBConstruct 1–21； UniProt 90–110 Author chain K； PDBConstruct 1–21； UniProt 90–110 Author chain Q； PDBConstruct 1–21； UniProt 90–110 Author chain S； PDBConstruct 1–21； UniProt 90–110 Author chain U； PDBConstruct 1–21； UniProt 90–110 Author chain X； PDBConstruct 1–21； UniProt 90–110 Author chain a； PDBConstruct 1–21； UniProt 90–110 Author chain c； PDBConstruct 1–21； UniProt 90–110 Author chain e； PDBConstruct 1–21； UniProt 90–110 Author chain g； PDBConstruct 1–21； UniProt 90–110 Author chain i； PDBConstruct 1–21； UniProt 90–110 Author chain k； PDBConstruct 1–21； UniProt 90–110 Author chain 2； PDBConstruct 1–30； UniProt 25–54 Author chain 4； PDBConstruct 1–30； UniProt 25–54 Author chain B； PDBConstruct 1–30； UniProt 25–54 Author chain D； PDBConstruct 1–30； UniProt 25–54 Author chain F； PDBConstruct 1–30； UniProt 25–54 Author chain H； PDBConstruct 1–30； UniProt 25–54 Author chain J； PDBConstruct 1–30； UniProt 25–54 Author chain L； PDBConstruct 1–30； UniProt 25–54 Author chain R； PDBConstruct 1–30； UniProt 25–54 Author chain T； PDBConstruct 1–30； UniProt 25–54 Author chain V； PDBConstruct 1–30； UniProt 25–54 Author chain Y； PDBConstruct 1–30； UniProt 25–54 Author chain b； PDBConstruct 1–30； UniProt 25–54 Author chain d； PDBConstruct 1–30； UniProt 25–54 Author chain f； PDBConstruct 1–30； UniProt 25–54 Author chain h； PDBConstruct 1–30； UniProt 25–54 Author chain j； PDBConstruct 1–30； UniProt 25–54 Author chain l； PDBConstruct 1–30； UniProt 25–54

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2om1
Deposition date deposition_date	2007-01-20
Structure title title	Structure of human insulin in presence of thiocyanate at pH 6.5
Keywords keywords	R6 conformation, hormone; HORMONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2om1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2om1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2om1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.22 Å
Rg (electron density)	18.04 Å
Total Rg	18.93 Å
Atom count	2431
Residues	301
Excluded volume	43253 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2om1__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2om1__assembly_2__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2om1__assembly_3__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Insulin A chain
Molecular weight formula_weight	2383.7 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,Q,S,U,X,1,3,a,c,e,g,i,k
Atom count atom_count	8076

GIVEQCCTSICSLYQLENYCN

Entity 2 Entity 2 polymer

Description description	Insulin B chain
Molecular weight formula_weight	3434.0 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,R,T,V,Y,2,4,b,d,f,h,j,l

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Entity 3 Entity 3 non-polymer

Description description	RESORCINOL
Molecular weight formula_weight	110.1 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 non-polymer

Description description	THIOCYANATE ION
Molecular weight formula_weight	58.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	755

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d2om121
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om141
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1b1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1d1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1f1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1h1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1j1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1l1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1r1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1t1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1v1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

Domain ID domain_id	d2om1y1
Class class	j — Peptides
Fold Fold fold	j.75 — Isolated insulin B-chain
Superfamily Superfamily superfamily	j.75.1 — Isolated insulin B-chain
Family Family family	j.75.1.1 — Isolated insulin B-chain

▶

Unit-cell length a length_a	59.000 Å
Unit-cell length b length_b	219.480 Å
Unit-cell length c length_c	224.480 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	144

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	1.970 Å
Low-resolution limit resolution_low	19.990 Å
R factor r_factor	0.1765
R_work r_work	0.1746
R_free r_free	0.2117

Structure of human insulin in presence of thiocyanate at pH 6.5

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2om1__assembly_1__model_1

2om1__assembly_1__model_1 | I(q)

2om1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (12 domains)

7. Citations (1)

Structure of human insulin in presence of thiocyanate at pH 6.5

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2om1__assembly_1__model_1

2om1__assembly_1__model_1 | I(q)

2om1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (12 domains)

7. Citations (1)