7abf

Human pre-Bact-1 spliceosome core structure

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein BUD31 homolog

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD31_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Q； PDBConstruct 1–144； UniProt 1–144

Pre-mRNA-splicing factor 38A

OrganismNot specified

UniProt Q8NAV1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PR38A_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–312； UniProt 1–312

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain r； PDBConstruct 1–972； UniProt 1–972

Zinc finger matrin-type protein 2

OrganismNot specified

UniProt Q96NC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ZMAT2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain N； PDBConstruct 1–199； UniProt 1–199

Ubiquitin-like protein 5

OrganismNot specified

UniProt Q9BZL1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UBL5_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain q； PDBConstruct 1–73； UniProt 1–73

Spliceosome-associated protein CWC15 homolog

OrganismNot specified

UniProt Q9P013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC15_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain R； PDBConstruct 1–229； UniProt 1–229

WW domain-binding protein 11

OrganismNot specified

UniProt Q9Y2W2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	WBP11_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain X； PDBConstruct 1–641； UniProt 1–641

SNW domain-containing protein 1

OrganismNot specified

UniProt Q13573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNW1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain v； PDBConstruct 1–536； UniProt 1–536

Pleiotropic regulator 1

OrganismNot specified

UniProt O43660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLRG1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain G； PDBConstruct 1–514； UniProt 1–514

Microfibrillar-associated protein 1

OrganismNot specified

UniProt P55081

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Transcription elongation regulator 1 × 1 （O14776） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MFAP1_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain K； PDBConstruct 1–439； UniProt 1–439

Transcription elongation regulator 1

OrganismNot specified

UniProt O14776

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 3	Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U5 small nuclear RNA × 1 U6 small nuclear RNA × 1 WW domain-binding protein 11 × 1 （Q9Y2W2） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） MINX M3 RNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCRG1_HUMAN
Isoform	O14776-2
PDB entities	15
Chains and sequence ranges	Author chain A4； PDBConstruct 1–1077； UniProt 1–1077

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7abf
Deposition date deposition_date	2020-09-07
Structure title title	Human pre-Bact-1 spliceosome core structure
Keywords keywords	Complex, spliceosome, catalytic activation, splicing; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7abf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7abf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7abf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.32 Å
Rg (electron density)	52.98 Å
Total Rg	52.99 Å
Atom count	25904
Residues	3884
Excluded volume	433810 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7abf__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	Protein BUD31 homolog
Molecular weight formula_weight	17032.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q
Atom count atom_count	25904

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Entity 2 Entity 2 polymer

Description description	Pre-mRNA-splicing factor 38A
Molecular weight formula_weight	37563.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPRVSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPRRRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRGNE

Entity 3 Entity 3 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 4 Entity 4 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 5 Entity 5 polymer

Description description	Zinc finger matrin-type protein 2
Molecular weight formula_weight	23664.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY

Entity 6 Entity 6 polymer

Description description	Ubiquitin-like protein 5
Molecular weight formula_weight	8560.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ

Entity 7 Entity 7 polymer

Description description	Spliceosome-associated protein CWC15 homolog
Molecular weight formula_weight	26674.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Entity 8 Entity 8 polymer

Description description	U5 small nuclear RNA
Molecular weight formula_weight	36908.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA

Entity 9 Entity 9 polymer

Description description	U6 small nuclear RNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Entity 10 Entity 10 polymer

Description description	WW domain-binding protein 11
Molecular weight formula_weight	70098.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDDSDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTSAATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL

Entity 11 Entity 11 polymer

Description description	SNW domain-containing protein 1
Molecular weight formula_weight	61610.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Entity 12 Entity 12 polymer

Description description	Pleiotropic regulator 1
Molecular weight formula_weight	57280.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

Entity 13 Entity 13 polymer

Description description	MINX M3 RNA
Molecular weight formula_weight	73712.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

GGGAGACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGCUUGCUGCACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUCCUGUCCCUUUUUUUUCCACAGCUCGCGGUUGAGGACAAACUCUUCGCGGUCUUUCCAGUGGGGAUCCAAUAUC

Entity 14 Entity 14 polymer

Description description	Microfibrillar-associated protein 1
Molecular weight formula_weight	52050.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSVPSALMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEFQFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVVGESDSEVEGDAWRMEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESESESEYEEYTDSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYTLKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKTT

Entity 15 Entity 15 polymer

Description description	Transcription elongation regulator 1
Molecular weight formula_weight	121870.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A4

MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMPPVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPPVMVPPFRVPLPGMPIPLPGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEPSEEPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK

Entity 16 Entity 16 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	84539

Human pre-Bact-1 spliceosome core structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein BUD31 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor 38A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

116 kDa U5 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Zinc finger matrin-type protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquitin-like protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spliceosome-associated protein CWC15 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

WW domain-binding protein 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SNW domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pleiotropic regulator 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer