8fkj

Yeast ATP Synthase in conformation-3, at pH 6

Method: ELECTRON MICROSCOPY D_max: 225.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 5, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain Y； UniProt 24–189	Not recorded	ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain Y 24–189（166 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A6A5Q1Y3_YEASX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Y； PDBConstruct 1–166； UniProt 24–189

ATP synthase subunit alpha

OrganismNot specified

UniProt A0A6A5Q4L9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain A； UniProt 39–545 Chain B； UniProt 39–545 Chain C； UniProt 39–545	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7MD2 The F1 region of ammocidin-bound Saccharomyces cerevisiae ATP synthase Deposited 2021-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–545（510 aa） Chain B 36–545（510 aa） Chain C 36–545（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 PO4 PHOSPHATE ION × 1 ZHD (3~{E},5~{Z},7~{E},9~{R},10~{S},11~{E},13~{E},15~{E},17~{R},18~{S},20~{S})-20-[(1~{R})-1-[(2~{S},3~{R},4~{R},5~{S},6~{R})-5-[(2~{S},4~{S},5~{S},6~{R})-5-[(2~{S},4~{R},5~{R},6~{R})-4,6-dimethyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-6-methyl-4-oxidanyl-oxan-2-yl]oxy-3-methoxy-6-(3-methoxypropyl)-5-methyl-2,4-bis(oxidanyl)oxan-2-yl]ethyl]-5,18-dimethoxy-3,7,9,11,13,15-hexamethyl-10-[(2~{R},3~{S},4~{R},5~{R},6~{S})-6-methyl-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-17-oxidanyl-1-oxacycloicosa-3,5,7,11,13,15-hexaen-2-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7MD3 The F1 region of apoptolidin-bound Saccharomyces cerevisiae ATP synthase Deposited 2021-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–545（510 aa） Chain B 36–545（510 aa） Chain C 36–545（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 PO4 PHOSPHATE ION × 1 ZH7 (3~{E},5~{E},7~{E},9~{R},10~{R},11~{E},13~{E},17~{S},18~{S},20~{S})-18-methoxy-20-[(~{R})-[(2~{R},3~{R},4~{S},5~{R},6~{R})-6-[(2~{R})-3-methoxy-2-[(2~{R},4~{S},5~{S},6~{S})-5-[(2~{S},4~{R},5~{R},6~{R})-4-methoxy-6-methyl-5-oxidanyl-oxan-2-yl]oxy-4,6-dimethyl-4-oxidanyl-oxan-2-yl]oxy-propyl]-3,5-dimethyl-2,4-bis(oxidanyl)oxan-2-yl]-oxidanyl-methyl]-10-[(2~{R},3~{S},4~{S},5~{R},6~{S})-5-methoxy-6-methyl-3,4-bis(oxidanyl)oxan-2-yl]oxy-3,5,7,9,13-pentamethyl-17-oxidanyl-1-oxacycloicosa-3,5,7,11,13-pentaen-2-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.30 Å
7TJS Yeast ATP synthase F1 region State 1-3catalytic beta_tight closed without exogenous ATP Deposited 2022-01-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 36–545（510 aa） Chain B 36–545（510 aa） Chain C 36–545（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
8F2K Structure of yeast F1-ATPase determined with 100 micromolar cruentaren A Deposited 2022-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 61–545（485 aa） Chain B 61–545（485 aa） Chain C 61–545（485 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 5 XBC Cruentaren A × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.90 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain A 39–545（507 aa） Chain B 39–545（507 aa） Chain C 39–545（507 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A6A5Q4L9_YEASX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–507； UniProt 39–545 Author chain B； PDBConstruct 1–507； UniProt 39–545 Author chain C； PDBConstruct 1–507； UniProt 39–545

ATP synthase subunit beta

OrganismNot specified

UniProt A0A6A5PX46

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain D； UniProt 39–511 Chain E； UniProt 39–511 Chain F； UniProt 39–511	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7MD2 The F1 region of ammocidin-bound Saccharomyces cerevisiae ATP synthase Deposited 2021-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain D 34–511（478 aa） Chain E 34–511（478 aa） Chain F 34–511（478 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 PO4 PHOSPHATE ION × 1 ZHD (3~{E},5~{Z},7~{E},9~{R},10~{S},11~{E},13~{E},15~{E},17~{R},18~{S},20~{S})-20-[(1~{R})-1-[(2~{S},3~{R},4~{R},5~{S},6~{R})-5-[(2~{S},4~{S},5~{S},6~{R})-5-[(2~{S},4~{R},5~{R},6~{R})-4,6-dimethyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-6-methyl-4-oxidanyl-oxan-2-yl]oxy-3-methoxy-6-(3-methoxypropyl)-5-methyl-2,4-bis(oxidanyl)oxan-2-yl]ethyl]-5,18-dimethoxy-3,7,9,11,13,15-hexamethyl-10-[(2~{R},3~{S},4~{R},5~{R},6~{S})-6-methyl-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-17-oxidanyl-1-oxacycloicosa-3,5,7,11,13,15-hexaen-2-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7MD3 The F1 region of apoptolidin-bound Saccharomyces cerevisiae ATP synthase Deposited 2021-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain D 34–511（478 aa） Chain E 34–511（478 aa） Chain F 34–511（478 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 PO4 PHOSPHATE ION × 1 ZH7 (3~{E},5~{E},7~{E},9~{R},10~{R},11~{E},13~{E},17~{S},18~{S},20~{S})-18-methoxy-20-[(~{R})-[(2~{R},3~{R},4~{S},5~{R},6~{R})-6-[(2~{R})-3-methoxy-2-[(2~{R},4~{S},5~{S},6~{S})-5-[(2~{S},4~{R},5~{R},6~{R})-4-methoxy-6-methyl-5-oxidanyl-oxan-2-yl]oxy-4,6-dimethyl-4-oxidanyl-oxan-2-yl]oxy-propyl]-3,5-dimethyl-2,4-bis(oxidanyl)oxan-2-yl]-oxidanyl-methyl]-10-[(2~{R},3~{S},4~{S},5~{R},6~{S})-5-methoxy-6-methyl-3,4-bis(oxidanyl)oxan-2-yl]oxy-3,5,7,9,13-pentamethyl-17-oxidanyl-1-oxacycloicosa-3,5,7,11,13-pentaen-2-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.30 Å
7TJS Yeast ATP synthase F1 region State 1-3catalytic beta_tight closed without exogenous ATP Deposited 2022-01-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 34–511（478 aa） Chain E 34–511（478 aa） Chain F 34–511（478 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
8F2K Structure of yeast F1-ATPase determined with 100 micromolar cruentaren A Deposited 2022-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 41–509（469 aa） Chain E 41–509（469 aa） Chain F 41–509（469 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 5 XBC Cruentaren A × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.90 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain D 39–511（473 aa） Chain E 39–511（473 aa） Chain F 39–511（473 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A6A5PX46_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–473； UniProt 39–511 Author chain E； PDBConstruct 1–473； UniProt 39–511 Author chain F； PDBConstruct 1–473； UniProt 39–511

ATP synthase subunit 9, mitochondrial

OrganismNot specified

UniProt A0A0G3F489

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain K； UniProt 2–75 Chain L； UniProt 2–75 Chain M； UniProt 2–75 Chain N； UniProt 2–75 Chain O； UniProt 2–75 Chain P； UniProt 2–75 Chain Q； UniProt 2–75 Chain R； UniProt 2–75 Chain S； UniProt 2–75 Chain T； UniProt 2–75	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7TJY Yeast ATP synthase State 1catalytic(a) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 0 1–76（76 aa） Chain 1 1–76（76 aa） Chain 2 1–76（76 aa） Chain 3 1–76（76 aa） Chain 4 1–76（76 aa） Chain 5 1–76（76 aa） Chain 6 1–76（76 aa） Chain 7 1–76（76 aa） Chain 8 1–76（76 aa） Chain 9 1–76（76 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7TJZ Yeast ATP synthase State 1catalytic(b) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 0 1–76（76 aa） Chain 1 1–76（76 aa） Chain 2 1–76（76 aa） Chain 3 1–76（76 aa） Chain 4 1–76（76 aa） Chain 5 1–76（76 aa） Chain 6 1–76（76 aa） Chain 7 1–76（76 aa） Chain 8 1–76（76 aa） Chain 9 1–76（76 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK0 Yeast ATP synthase State 1catalytic(c) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 0 1–76（76 aa） Chain 1 1–76（76 aa） Chain 2 1–76（76 aa） Chain 3 1–76（76 aa） Chain 4 1–76（76 aa） Chain 5 1–76（76 aa） Chain 6 1–76（76 aa） Chain 7 1–76（76 aa） Chain 8 1–76（76 aa） Chain 9 1–76（76 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK1 Yeast ATP synthase State 1catalytic(d) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 0 1–76（76 aa） Chain 1 1–76（76 aa） Chain 2 1–76（76 aa） Chain 3 1–76（76 aa） Chain 4 1–76（76 aa） Chain 5 1–76（76 aa） Chain 6 1–76（76 aa） Chain 7 1–76（76 aa） Chain 8 1–76（76 aa） Chain 9 1–76（76 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different construct Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain K 1–75（75 aa） Chain L 1–75（75 aa） Chain M 1–75（75 aa） Chain N 1–75（75 aa） Chain O 1–75（75 aa） Chain P 1–75（75 aa） Chain Q 1–75（75 aa） Chain R 1–75（75 aa） Chain S 1–75（75 aa） Chain T 1–75（75 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0G3F489_YEASX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–74； UniProt 2–75 Author chain L； PDBConstruct 1–74； UniProt 2–75 Author chain M； PDBConstruct 1–74； UniProt 2–75 Author chain N； PDBConstruct 1–74； UniProt 2–75 Author chain O； PDBConstruct 1–74； UniProt 2–75 Author chain P； PDBConstruct 1–74； UniProt 2–75 Author chain Q； PDBConstruct 1–74； UniProt 2–75 Author chain R； PDBConstruct 1–74； UniProt 2–75 Author chain S； PDBConstruct 1–74； UniProt 2–75 Author chain T； PDBConstruct 1–74； UniProt 2–75

ATP synthase subunit 4, mitochondrial

OrganismNot specified

UniProt P05626

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain Z； UniProt 88–242	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6B2Z Cryo-EM structure of the dimeric FO region of yeast mitochondrial ATP synthase Deposited 2017-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain N 36–244（209 aa） Chain b 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；blot for 26 seconds before plunging	Resolution 3.60 Å
6B8H Mosaic model of yeast mitochondrial ATP synthase monomer Deposited 2017-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain b 36–244（209 aa） Chain q 36–244（209 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MG MAGNESIUM ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
6CP3 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc with inhibitor of oligomycin bound. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain Z 36–244（209 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6CP5 Monomer yeast ATP synthase Fo reconstituted in nanodisc with inhibitor of oligomycin bound generated from focused refinement. Deposited 2018-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain Z 36–244（209 aa）	Not recorded	EFO Oligomycin A × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6CP6 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain Z 36–244（209 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6CP7 Monomer yeast ATP synthase Fo reconstituted in nanodisc generated from masked refinement. Deposited 2018-03-13	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain Z 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6WTD Monomer yeast ATP synthase Fo reconstituted in nanodisc with inhibitor of Bedaquiline bound Deposited 2020-05-02	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain Z 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
7TJY Yeast ATP synthase State 1catalytic(a) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7TJZ Yeast ATP synthase State 1catalytic(b) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK0 Yeast ATP synthase State 1catalytic(c) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK1 Yeast ATP synthase State 1catalytic(d) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TK2 Yeast ATP synthase State 1binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK3 Yeast ATP synthase State 1binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TK4 Yeast ATP synthase State 1binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.00 Å
7TK5 Yeast ATP synthase State 1binding(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.80 Å
7TK6 Yeast ATP synthase State 1catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK7 Yeast ATP synthase State 1catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.70 Å
7TK8 Yeast ATP synthase State 1catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.70 Å
7TK9 Yeast ATP synthase State 1catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.00 Å
7TKA Yeast ATP synthase State 1catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKB Yeast ATP synthase State 1catalytic(f) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TKC Yeast ATP synthase State 1catalytic(g) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 5.80 Å
7TKD Yeast ATP synthase State 1catalytic(h) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.70 Å
7TKE Yeast ATP synthase State 2binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKF Yeast ATP synthase State 2binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKG Yeast ATP synthase State 2catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKH Yeast ATP synthase State 2catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TKI Yeast ATP synthase State 2catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKJ Yeast ATP synthase State 2catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
7TKK Yeast ATP synthase State 2catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.30 Å
7TKL Yeast ATP synthase State 3binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.40 Å
7TKM Yeast ATP synthase State 3binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKN Yeast ATP synthase State 3binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKP Yeast ATP synthase State 3catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7TKQ Yeast ATP synthase State 3catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKR Yeast ATP synthase State 3catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TKS Yeast ATP synthase State 3catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 36–244（209 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
8F29 Yeast ATP synthase in conformation-1 at pH 6 Deposited 2022-11-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain Z 88–242（155 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8F39 Yeast ATP synthase in conformation-2, at pH 6 Deposited 2022-11-09	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain Z 88–242（155 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain Z 88–242（155 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

40 other PDB entries and 40 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATPF_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Z； PDBConstruct 1–155； UniProt 88–242

ATP synthase subunit d, mitochondrial

OrganismNot specified

UniProt P30902

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain 7； UniProt 4–174	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6B2Z Cryo-EM structure of the dimeric FO region of yeast mitochondrial ATP synthase Deposited 2017-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain O 2–174（173 aa） Chain d 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；blot for 26 seconds before plunging	Resolution 3.60 Å
6B8H Mosaic model of yeast mitochondrial ATP synthase monomer Deposited 2017-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain d 2–174（173 aa） Chain r 2–174（173 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MG MAGNESIUM ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
6CP3 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc with inhibitor of oligomycin bound. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 7 2–174（173 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6CP5 Monomer yeast ATP synthase Fo reconstituted in nanodisc with inhibitor of oligomycin bound generated from focused refinement. Deposited 2018-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 7 2–174（173 aa）	Not recorded	EFO Oligomycin A × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6CP6 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 7 2–174（173 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6CP7 Monomer yeast ATP synthase Fo reconstituted in nanodisc generated from masked refinement. Deposited 2018-03-13	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 7 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6WTD Monomer yeast ATP synthase Fo reconstituted in nanodisc with inhibitor of Bedaquiline bound Deposited 2020-05-02	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 7 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
7TJY Yeast ATP synthase State 1catalytic(a) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7TJZ Yeast ATP synthase State 1catalytic(b) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK0 Yeast ATP synthase State 1catalytic(c) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK1 Yeast ATP synthase State 1catalytic(d) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TK2 Yeast ATP synthase State 1binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK3 Yeast ATP synthase State 1binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TK4 Yeast ATP synthase State 1binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.00 Å
7TK5 Yeast ATP synthase State 1binding(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.80 Å
7TK6 Yeast ATP synthase State 1catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK7 Yeast ATP synthase State 1catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.70 Å
7TK8 Yeast ATP synthase State 1catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.70 Å
7TK9 Yeast ATP synthase State 1catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.00 Å
7TKA Yeast ATP synthase State 1catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKB Yeast ATP synthase State 1catalytic(f) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TKC Yeast ATP synthase State 1catalytic(g) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 5.80 Å
7TKD Yeast ATP synthase State 1catalytic(h) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.70 Å
7TKE Yeast ATP synthase State 2binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKF Yeast ATP synthase State 2binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKG Yeast ATP synthase State 2catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKH Yeast ATP synthase State 2catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TKI Yeast ATP synthase State 2catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKJ Yeast ATP synthase State 2catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
7TKK Yeast ATP synthase State 2catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.30 Å
7TKL Yeast ATP synthase State 3binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.40 Å
7TKM Yeast ATP synthase State 3binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKN Yeast ATP synthase State 3binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKO Yeast ATP synthase State 3catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.80 Å
7TKP Yeast ATP synthase State 3catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7TKQ Yeast ATP synthase State 3catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKR Yeast ATP synthase State 3catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TKS Yeast ATP synthase State 3catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain V 2–174（173 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
8F29 Yeast ATP synthase in conformation-1 at pH 6 Deposited 2022-11-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 7 4–174（171 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8F39 Yeast ATP synthase in conformation-2, at pH 6 Deposited 2022-11-09	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 7 4–174（171 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 7 4–174（171 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

41 other PDB entries and 41 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATP7_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 7； PDBConstruct 1–171； UniProt 4–174

ATP synthase subunit H, mitochondrial

OrganismNot specified

UniProt Q12349

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain 6； UniProt 36–124	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6CP3 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc with inhibitor of oligomycin bound. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 6 33–124（92 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6CP6 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 6 33–124（92 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7TJY Yeast ATP synthase State 1catalytic(a) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7TJZ Yeast ATP synthase State 1catalytic(b) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK0 Yeast ATP synthase State 1catalytic(c) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK1 Yeast ATP synthase State 1catalytic(d) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TK2 Yeast ATP synthase State 1binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK3 Yeast ATP synthase State 1binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TK4 Yeast ATP synthase State 1binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.00 Å
7TK5 Yeast ATP synthase State 1binding(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.80 Å
7TK6 Yeast ATP synthase State 1catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK7 Yeast ATP synthase State 1catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.70 Å
7TK8 Yeast ATP synthase State 1catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.70 Å
7TK9 Yeast ATP synthase State 1catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.00 Å
7TKA Yeast ATP synthase State 1catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKB Yeast ATP synthase State 1catalytic(f) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TKC Yeast ATP synthase State 1catalytic(g) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 5.80 Å
7TKD Yeast ATP synthase State 1catalytic(h) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.70 Å
7TKE Yeast ATP synthase State 2binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKF Yeast ATP synthase State 2binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKG Yeast ATP synthase State 2catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKH Yeast ATP synthase State 2catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TKI Yeast ATP synthase State 2catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKJ Yeast ATP synthase State 2catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
7TKK Yeast ATP synthase State 2catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.30 Å
7TKL Yeast ATP synthase State 3binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.40 Å
7TKM Yeast ATP synthase State 3binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKN Yeast ATP synthase State 3binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKO Yeast ATP synthase State 3catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.80 Å
7TKP Yeast ATP synthase State 3catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7TKQ Yeast ATP synthase State 3catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKR Yeast ATP synthase State 3catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TKS Yeast ATP synthase State 3catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain X 33–124（92 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
8F29 Yeast ATP synthase in conformation-1 at pH 6 Deposited 2022-11-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 6 36–124（89 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8F39 Yeast ATP synthase in conformation-2, at pH 6 Deposited 2022-11-09	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 6 36–124（89 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 6 36–124（89 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

36 other PDB entries and 36 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATP14_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 6； PDBConstruct 1–89； UniProt 36–124

ATP synthase subunit f, mitochondrial

OrganismNot specified

UniProt Q06405

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain U； UniProt 7–91	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6B2Z Cryo-EM structure of the dimeric FO region of yeast mitochondrial ATP synthase Deposited 2017-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain Q 7–101（95 aa） Chain f 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；blot for 26 seconds before plunging	Resolution 3.60 Å
6B8H Mosaic model of yeast mitochondrial ATP synthase monomer Deposited 2017-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain f 7–101（95 aa） Chain t 7–101（95 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MG MAGNESIUM ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
6CP3 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc with inhibitor of oligomycin bound. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 7–101（95 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6CP5 Monomer yeast ATP synthase Fo reconstituted in nanodisc with inhibitor of oligomycin bound generated from focused refinement. Deposited 2018-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain U 7–101（95 aa）	Not recorded	EFO Oligomycin A × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6CP6 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 7–101（95 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6CP7 Monomer yeast ATP synthase Fo reconstituted in nanodisc generated from masked refinement. Deposited 2018-03-13	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain U 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6WTD Monomer yeast ATP synthase Fo reconstituted in nanodisc with inhibitor of Bedaquiline bound Deposited 2020-05-02	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain U 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
7TJY Yeast ATP synthase State 1catalytic(a) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7TJZ Yeast ATP synthase State 1catalytic(b) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK0 Yeast ATP synthase State 1catalytic(c) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK1 Yeast ATP synthase State 1catalytic(d) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TK2 Yeast ATP synthase State 1binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK3 Yeast ATP synthase State 1binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TK4 Yeast ATP synthase State 1binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.00 Å
7TK5 Yeast ATP synthase State 1binding(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.80 Å
7TK6 Yeast ATP synthase State 1catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK7 Yeast ATP synthase State 1catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.70 Å
7TK8 Yeast ATP synthase State 1catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.70 Å
7TK9 Yeast ATP synthase State 1catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.00 Å
7TKA Yeast ATP synthase State 1catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKB Yeast ATP synthase State 1catalytic(f) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TKC Yeast ATP synthase State 1catalytic(g) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 5.80 Å
7TKD Yeast ATP synthase State 1catalytic(h) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.70 Å
7TKE Yeast ATP synthase State 2binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKF Yeast ATP synthase State 2binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKG Yeast ATP synthase State 2catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKH Yeast ATP synthase State 2catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TKI Yeast ATP synthase State 2catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKJ Yeast ATP synthase State 2catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
7TKK Yeast ATP synthase State 2catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.30 Å
7TKL Yeast ATP synthase State 3binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.40 Å
7TKM Yeast ATP synthase State 3binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKN Yeast ATP synthase State 3binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKO Yeast ATP synthase State 3catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.80 Å
7TKP Yeast ATP synthase State 3catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7TKQ Yeast ATP synthase State 3catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKR Yeast ATP synthase State 3catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TKS Yeast ATP synthase State 3catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain W 7–101（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
8F29 Yeast ATP synthase in conformation-1 at pH 6 Deposited 2022-11-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 7–91（85 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8F39 Yeast ATP synthase in conformation-2, at pH 6 Deposited 2022-11-09	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 7–91（85 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 7–91（85 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

41 other PDB entries and 41 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATPK_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain U； PDBConstruct 1–85； UniProt 7–91

ATP synthase protein 8

OrganismNot specified

UniProt A0A0G3F1I9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain 8； UniProt 7–47	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain 8 7–47（41 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0G3F1I9_YEASX
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 8； PDBConstruct 1–41； UniProt 7–47

ATP synthase subunit a

OrganismNot specified

UniProt A0A0H3WKN0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain X； UniProt 36–259	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0H3WKN0_YEASX
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain X； PDBConstruct 1–224； UniProt 36–259

ATP18 isoform 1

OrganismNot specified

UniProt A0A6A5PRS1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain J； UniProt 1–37	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain J 1–37（37 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A6A5PRS1_YEASX
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain J； PDBConstruct 1–37； UniProt 1–37

ATP synthase subunit gamma

OrganismNot specified

UniProt A0A6A5Q493

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain G； UniProt 38–307	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7MD2 The F1 region of ammocidin-bound Saccharomyces cerevisiae ATP synthase Deposited 2021-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 34–311（278 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 PO4 PHOSPHATE ION × 1 ZHD (3~{E},5~{Z},7~{E},9~{R},10~{S},11~{E},13~{E},15~{E},17~{R},18~{S},20~{S})-20-[(1~{R})-1-[(2~{S},3~{R},4~{R},5~{S},6~{R})-5-[(2~{S},4~{S},5~{S},6~{R})-5-[(2~{S},4~{R},5~{R},6~{R})-4,6-dimethyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-6-methyl-4-oxidanyl-oxan-2-yl]oxy-3-methoxy-6-(3-methoxypropyl)-5-methyl-2,4-bis(oxidanyl)oxan-2-yl]ethyl]-5,18-dimethoxy-3,7,9,11,13,15-hexamethyl-10-[(2~{R},3~{S},4~{R},5~{R},6~{S})-6-methyl-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-17-oxidanyl-1-oxacycloicosa-3,5,7,11,13,15-hexaen-2-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7MD3 The F1 region of apoptolidin-bound Saccharomyces cerevisiae ATP synthase Deposited 2021-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 34–311（278 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 PO4 PHOSPHATE ION × 1 ZH7 (3~{E},5~{E},7~{E},9~{R},10~{R},11~{E},13~{E},17~{S},18~{S},20~{S})-18-methoxy-20-[(~{R})-[(2~{R},3~{R},4~{S},5~{R},6~{R})-6-[(2~{R})-3-methoxy-2-[(2~{R},4~{S},5~{S},6~{S})-5-[(2~{S},4~{R},5~{R},6~{R})-4-methoxy-6-methyl-5-oxidanyl-oxan-2-yl]oxy-4,6-dimethyl-4-oxidanyl-oxan-2-yl]oxy-propyl]-3,5-dimethyl-2,4-bis(oxidanyl)oxan-2-yl]-oxidanyl-methyl]-10-[(2~{R},3~{S},4~{S},5~{R},6~{S})-5-methoxy-6-methyl-3,4-bis(oxidanyl)oxan-2-yl]oxy-3,5,7,9,13-pentamethyl-17-oxidanyl-1-oxacycloicosa-3,5,7,11,13-pentaen-2-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.30 Å
7TJS Yeast ATP synthase F1 region State 1-3catalytic beta_tight closed without exogenous ATP Deposited 2022-01-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain G 34–311（278 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
8F2K Structure of yeast F1-ATPase determined with 100 micromolar cruentaren A Deposited 2022-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain G 34–308（275 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 5 XBC Cruentaren A × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.90 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A6A5Q493_YEASX
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain G； PDBConstruct 1–270； UniProt 38–307

ATP synthase subunit delta, mitochondrial

OrganismNot specified

UniProt Q12165

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain H； UniProt 29–160	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit epsilon, mitochondrial × 1 （P21306）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2HLD Crystal structure of yeast mitochondrial F1-ATPase Deposited 2006-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 23–160（138 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% glycerol, 4% methanol, 0.05M sodium acetate, 0.5mM nickel sulphate, 0.5mM AMP/PNP, 0.025 mM ADP, 2mM magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.244
2HLD Crystal structure of yeast mitochondrial F1-ATPase Deposited 2006-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 23–160（138 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% glycerol, 4% methanol, 0.05M sodium acetate, 0.5mM nickel sulphate, 0.5mM AMP/PNP, 0.025 mM ADP, 2mM magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.244
2HLD Crystal structure of yeast mitochondrial F1-ATPase Deposited 2006-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Z 23–160（138 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% glycerol, 4% methanol, 0.05M sodium acetate, 0.5mM nickel sulphate, 0.5mM AMP/PNP, 0.025 mM ADP, 2mM magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.244
2WPD The Mg.ADP inhibited state of the yeast F1c10 ATP synthase Deposited 2009-08-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain H 23–160（138 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M HEPES/HCL PH 7.5, 12% PEG MME 5000, 100 MM SODIUM CHLORIDE MIXED 1:1 WITH PROTEIN SOLUTION CONTAINING 0.64 MM DDM, 25 MM TRIS/HCL PH 8.0, 100 MM SODIUM CHLORIDE, 25 MM TREHALOSE, 0.5 MM EDTA, 0.02% SODIUM AZIDE, 2 MM MAGNESIUM CHLORIDE, 0.66 MM ADP, 0.1 MM DCCD, 2.5 MM DTT, 0.5 MM PMSF	Resolution 3.43 Å R-free 0.297
2XOK Refined structure of yeast F1c10 ATPase complex to 3 A resolution Deposited 2010-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain H 1–160（160 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 8；0.1 M TRIS/CL PH8.0, 12% PEG 6000, 150 MM NACL, 1 MM AMP-PNP, 40 MICROM ADP, 1 MM DTT, 0.02% NAN3. MIXED 1:1 WITH PROTEIN SOLUTION UNDER PARAFFIN OIL IN MICROBATCH PLATE.	Resolution 3.01 Å R-free 0.253
3FKS Yeast F1 ATPase in the absence of bound nucleotides Deposited 2008-12-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 23–160（138 aa） Fragment：UNP residues 23-160	Not recorded	PO4 PHOSPHATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；6.25% PEG 6000, 10% Glycerol, 4% Methanol, 0.05M Sodium acetate, 0.5mM Nickel sulfate, 2 mM Sodium pyrophosphate, 2mM Magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277.0K	Resolution 3.59 Å R-free 0.306
3FKS Yeast F1 ATPase in the absence of bound nucleotides Deposited 2008-12-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 23–160（138 aa） Fragment：UNP residues 23-160	Not recorded	PO4 PHOSPHATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；6.25% PEG 6000, 10% Glycerol, 4% Methanol, 0.05M Sodium acetate, 0.5mM Nickel sulfate, 2 mM Sodium pyrophosphate, 2mM Magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277.0K	Resolution 3.59 Å R-free 0.306
3FKS Yeast F1 ATPase in the absence of bound nucleotides Deposited 2008-12-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Z 23–160（138 aa） Fragment：UNP residues 23-160	Not recorded	PO4 PHOSPHATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；6.25% PEG 6000, 10% Glycerol, 4% Methanol, 0.05M Sodium acetate, 0.5mM Nickel sulfate, 2 mM Sodium pyrophosphate, 2mM Magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277.0K	Resolution 3.59 Å R-free 0.306
3OE7 Structure of four mutant forms of yeast f1 ATPase: gamma-I270T Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 24–160（137 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, PH 7.3, VAPOR DIFFUSION SITTING DROP, TEMPERATURE 277K	Resolution 3.19 Å R-free 0.245
3OE7 Structure of four mutant forms of yeast f1 ATPase: gamma-I270T Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 24–160（137 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, PH 7.3, VAPOR DIFFUSION SITTING DROP, TEMPERATURE 277K	Resolution 3.19 Å R-free 0.245
3OE7 Structure of four mutant forms of yeast f1 ATPase: gamma-I270T Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Z 24–160（137 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, PH 7.3, VAPOR DIFFUSION SITTING DROP, TEMPERATURE 277K	Resolution 3.19 Å R-free 0.245
3OEE Structure of four mutant forms of yeast F1 ATPase: alpha-F405S Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 23–160（138 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.74 Å R-free 0.259
3OEE Structure of four mutant forms of yeast F1 ATPase: alpha-F405S Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 23–160（138 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.74 Å R-free 0.259
3OEE Structure of four mutant forms of yeast F1 ATPase: alpha-F405S Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Z 23–160（138 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.74 Å R-free 0.259
3OEH Structure of four mutant forms of yeast F1 ATPase: beta-V279F Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 23–160（138 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.270
3OEH Structure of four mutant forms of yeast F1 ATPase: beta-V279F Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 23–160（138 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.270
3OEH Structure of four mutant forms of yeast F1 ATPase: beta-V279F Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Z 23–160（138 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.270
3OFN Structure of four mutant forms of yeast F1 ATPase: alpha-N67I Deposited 2010-08-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 23–160（138 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.20 Å R-free 0.276
3OFN Structure of four mutant forms of yeast F1 ATPase: alpha-N67I Deposited 2010-08-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 23–160（138 aa） Fragment：UNP RESIDUES 23-160	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.20 Å R-free 0.276
3ZIA The structure of F1-ATPase from Saccharomyces cerevisiae inhibited by its regulatory protein IF1 Deposited 2013-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain R 23–160（138 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 5 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 7.5；296 K；ACTIVE F1-ATPASE (12 MG/ML) WAS EXCHANGED ON A DESALTING COLUMN INTO CRYSTALLISATION BUFFER, PREPARED IN D2O CONSISTING OF 100 MM BIS-TRIS PROPANE, PH 7.5, 100 MM SUCROSE, 1 MM ADP AND 10 MM MAGNESIUM SULPHATE. THEN THE ENZYME WAS INHIBITED AT 23C WITH A 4-FOLD MOLAR EXCESS OF YI1-53 (MUTATION E21A) IN THE PRESENCE OF 1 MM ATP AND 2 MM MAGNESIUM SULPHATE. FURTHER PORTIONS (5 UL OF A NEUTRALISED STOCK SOLUTION CONTAINING 200 MM ATP AND 400 MM MAGNESIUM SULPHATE/ML PROTEIN SOLUTION) WERE ADDED AFTER 5 AND 10 MIN. MORE THAN 95% OF THE ATP HYDROLYSIS ACTIVITY OF THE ENZYME WAS INHIBITED. SODIUM-POTASSIUM TARTRATE WAS ADDED TO 100 MM, AND THE CONCENTRATION OF THE PROTEIN SOLUTION WAS ADJUSTED TO 10 MG/ML WITH CRYSTALLISATION BUFFER. CRYSTALS WERE GROWN AT 23C IN 72 WELL MICRO-BATCH PLATES UNDER FILTERED PARAFFIN OIL. THE CRYSTALLISATION DROPS (4 UL) CONTAINED A 1:1 MIXTURE OF PROTEIN SOLUTION AND PRECIPITANT SOLUTION (20%-26% POLYETHYLENE GLYCOL 3000 AND 600 MM NACL PREPARED IN D2O).	Resolution 2.50 Å R-free 0.262
3ZIA The structure of F1-ATPase from Saccharomyces cerevisiae inhibited by its regulatory protein IF1 Deposited 2013-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain H 23–160（138 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 5 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 7.5；296 K；ACTIVE F1-ATPASE (12 MG/ML) WAS EXCHANGED ON A DESALTING COLUMN INTO CRYSTALLISATION BUFFER, PREPARED IN D2O CONSISTING OF 100 MM BIS-TRIS PROPANE, PH 7.5, 100 MM SUCROSE, 1 MM ADP AND 10 MM MAGNESIUM SULPHATE. THEN THE ENZYME WAS INHIBITED AT 23C WITH A 4-FOLD MOLAR EXCESS OF YI1-53 (MUTATION E21A) IN THE PRESENCE OF 1 MM ATP AND 2 MM MAGNESIUM SULPHATE. FURTHER PORTIONS (5 UL OF A NEUTRALISED STOCK SOLUTION CONTAINING 200 MM ATP AND 400 MM MAGNESIUM SULPHATE/ML PROTEIN SOLUTION) WERE ADDED AFTER 5 AND 10 MIN. MORE THAN 95% OF THE ATP HYDROLYSIS ACTIVITY OF THE ENZYME WAS INHIBITED. SODIUM-POTASSIUM TARTRATE WAS ADDED TO 100 MM, AND THE CONCENTRATION OF THE PROTEIN SOLUTION WAS ADJUSTED TO 10 MG/ML WITH CRYSTALLISATION BUFFER. CRYSTALS WERE GROWN AT 23C IN 72 WELL MICRO-BATCH PLATES UNDER FILTERED PARAFFIN OIL. THE CRYSTALLISATION DROPS (4 UL) CONTAINED A 1:1 MIXTURE OF PROTEIN SOLUTION AND PRECIPITANT SOLUTION (20%-26% POLYETHYLENE GLYCOL 3000 AND 600 MM NACL PREPARED IN D2O).	Resolution 2.50 Å R-free 0.262
3ZRY Rotor architecture in the F(1)-c(10)-ring complex of the yeast F-ATP synthase Deposited 2011-06-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 23–160（138 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；10% PEG 4000, 100 MM SODIUM CHLORIDE, 100 MM HEPES PH 6.5 MIXED 1:1 WITH PROTEIN SOLUTION (10 MG/ML) CONTAINING 0.64 MM DDM, 25 MM TRIS PH 8.0, 100 MM SODIUM CHLORIDE, 25 MM TREHALOSE, 0.5 MM EDTA, 3 MM SODIUM AZIDE, 2 MM MAGNESIUM CHLORIDE, 0.04 MM ADP, 1 MM AMP-PNP, 0.1 MM DCCD, 2.5 MM DTT, 0.5 MM PMSF.	Resolution 6.50 Å R-free 0.339
4B2Q Model of the yeast F1Fo-ATP synthase dimer based on subtomogram average Deposited 2012-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain H 29–160（132 aa） Fragment：RESIDUES 29-160 Chain h 29–160（132 aa） Fragment：RESIDUES 29-160	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6 MG MAGNESIUM ION × 10 ADP ADENOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer 250MM TREHALOSE 10NM TRIS- HCL PH7.4；pH 7.4；250MM TREHALOSE 10NM TRIS- HCL PH7.4 cryo-EM vitrification conditions Cryogen ETHANE；VITRIFICATION 1 -- CRYOGEN- ETHANE, TEMPERATURE- 100, INSTRUMENT- HOMEMADE PLUNGER, METHOD- SINGLE SIDE MANUAL BLOTTING FOR 5 SECONDS.,	Resolution 37.00 Å
6B8H Mosaic model of yeast mitochondrial ATP synthase monomer Deposited 2017-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain H 23–160（138 aa） Chain l 23–160（138 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MG MAGNESIUM ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
6CP3 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc with inhibitor of oligomycin bound. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6CP6 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7TJY Yeast ATP synthase State 1catalytic(a) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7TJZ Yeast ATP synthase State 1catalytic(b) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK0 Yeast ATP synthase State 1catalytic(c) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK1 Yeast ATP synthase State 1catalytic(d) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TK2 Yeast ATP synthase State 1binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK3 Yeast ATP synthase State 1binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TK4 Yeast ATP synthase State 1binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.00 Å
7TK5 Yeast ATP synthase State 1binding(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.80 Å
7TK6 Yeast ATP synthase State 1catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK7 Yeast ATP synthase State 1catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.70 Å
7TK8 Yeast ATP synthase State 1catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.70 Å
7TK9 Yeast ATP synthase State 1catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.00 Å
7TKA Yeast ATP synthase State 1catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKB Yeast ATP synthase State 1catalytic(f) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TKC Yeast ATP synthase State 1catalytic(g) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 5.80 Å
7TKD Yeast ATP synthase State 1catalytic(h) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.70 Å
7TKE Yeast ATP synthase State 2binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKF Yeast ATP synthase State 2binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKG Yeast ATP synthase State 2catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKH Yeast ATP synthase State 2catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TKI Yeast ATP synthase State 2catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKJ Yeast ATP synthase State 2catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
7TKK Yeast ATP synthase State 2catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.30 Å
7TKL Yeast ATP synthase State 3binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.40 Å
7TKM Yeast ATP synthase State 3binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKN Yeast ATP synthase State 3binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKO Yeast ATP synthase State 3catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.80 Å
7TKP Yeast ATP synthase State 3catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7TKQ Yeast ATP synthase State 3catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKR Yeast ATP synthase State 3catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TKS Yeast ATP synthase State 3catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 23–160（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
8F29 Yeast ATP synthase in conformation-1 at pH 6 Deposited 2022-11-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 29–160（132 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8F39 Yeast ATP synthase in conformation-2, at pH 6 Deposited 2022-11-09	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 29–160（132 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain H 29–160（132 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

48 other PDB entries and 60 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATPD_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain H； PDBConstruct 1–132； UniProt 29–160

ATP synthase subunit epsilon, mitochondrial

OrganismNot specified

UniProt P21306

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain I； UniProt 2–60	Not recorded	ATP synthase subunit 5, mitochondrial × 1 （A0A6A5Q1Y3） ATP synthase subunit alpha × 3 （A0A6A5Q4L9） ATP synthase subunit beta × 3 （A0A6A5PX46） ATP synthase subunit 9, mitochondrial × 10 （A0A0G3F489） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （A0A0G3F1I9） ATP synthase subunit a × 1 （A0A0H3WKN0） ATP18 isoform 1 × 1 （A0A6A5PRS1） ATP synthase subunit gamma × 1 （A0A6A5Q493） ATP synthase subunit delta, mitochondrial × 1 （Q12165）	ELECTRON MICROSCOPY cryo-EM buffer：pH 6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8FKJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2HLD Crystal structure of yeast mitochondrial F1-ATPase Deposited 2006-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 1–61（61 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% glycerol, 4% methanol, 0.05M sodium acetate, 0.5mM nickel sulphate, 0.5mM AMP/PNP, 0.025 mM ADP, 2mM magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.244
2HLD Crystal structure of yeast mitochondrial F1-ATPase Deposited 2006-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain R 1–61（61 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% glycerol, 4% methanol, 0.05M sodium acetate, 0.5mM nickel sulphate, 0.5mM AMP/PNP, 0.025 mM ADP, 2mM magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.244
2HLD Crystal structure of yeast mitochondrial F1-ATPase Deposited 2006-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain 1 1–61（61 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% glycerol, 4% methanol, 0.05M sodium acetate, 0.5mM nickel sulphate, 0.5mM AMP/PNP, 0.025 mM ADP, 2mM magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.244
2WPD The Mg.ADP inhibited state of the yeast F1c10 ATP synthase Deposited 2009-08-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain I 2–62（61 aa） Fragment：RESIDUES 2-62	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M HEPES/HCL PH 7.5, 12% PEG MME 5000, 100 MM SODIUM CHLORIDE MIXED 1:1 WITH PROTEIN SOLUTION CONTAINING 0.64 MM DDM, 25 MM TRIS/HCL PH 8.0, 100 MM SODIUM CHLORIDE, 25 MM TREHALOSE, 0.5 MM EDTA, 0.02% SODIUM AZIDE, 2 MM MAGNESIUM CHLORIDE, 0.66 MM ADP, 0.1 MM DCCD, 2.5 MM DTT, 0.5 MM PMSF	Resolution 3.43 Å R-free 0.297
3FKS Yeast F1 ATPase in the absence of bound nucleotides Deposited 2008-12-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 2–62（61 aa） Fragment：UNP residues 2-62	Not recorded	PO4 PHOSPHATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；6.25% PEG 6000, 10% Glycerol, 4% Methanol, 0.05M Sodium acetate, 0.5mM Nickel sulfate, 2 mM Sodium pyrophosphate, 2mM Magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277.0K	Resolution 3.59 Å R-free 0.306
3FKS Yeast F1 ATPase in the absence of bound nucleotides Deposited 2008-12-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain R 2–62（61 aa） Fragment：UNP residues 2-62	Not recorded	PO4 PHOSPHATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；6.25% PEG 6000, 10% Glycerol, 4% Methanol, 0.05M Sodium acetate, 0.5mM Nickel sulfate, 2 mM Sodium pyrophosphate, 2mM Magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277.0K	Resolution 3.59 Å R-free 0.306
3FKS Yeast F1 ATPase in the absence of bound nucleotides Deposited 2008-12-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain 1 2–62（61 aa） Fragment：UNP residues 2-62	Not recorded	PO4 PHOSPHATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；6.25% PEG 6000, 10% Glycerol, 4% Methanol, 0.05M Sodium acetate, 0.5mM Nickel sulfate, 2 mM Sodium pyrophosphate, 2mM Magnesium chloride, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277.0K	Resolution 3.59 Å R-free 0.306
3OE7 Structure of four mutant forms of yeast f1 ATPase: gamma-I270T Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, PH 7.3, VAPOR DIFFUSION SITTING DROP, TEMPERATURE 277K	Resolution 3.19 Å R-free 0.245
3OE7 Structure of four mutant forms of yeast f1 ATPase: gamma-I270T Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain R 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, PH 7.3, VAPOR DIFFUSION SITTING DROP, TEMPERATURE 277K	Resolution 3.19 Å R-free 0.245
3OE7 Structure of four mutant forms of yeast f1 ATPase: gamma-I270T Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain 1 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, PH 7.3, VAPOR DIFFUSION SITTING DROP, TEMPERATURE 277K	Resolution 3.19 Å R-free 0.245
3OEE Structure of four mutant forms of yeast F1 ATPase: alpha-F405S Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.74 Å R-free 0.259
3OEE Structure of four mutant forms of yeast F1 ATPase: alpha-F405S Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain R 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.74 Å R-free 0.259
3OEE Structure of four mutant forms of yeast F1 ATPase: alpha-F405S Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain 1 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.74 Å R-free 0.259
3OEH Structure of four mutant forms of yeast F1 ATPase: beta-V279F Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.270
3OEH Structure of four mutant forms of yeast F1 ATPase: beta-V279F Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain R 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.270
3OEH Structure of four mutant forms of yeast F1 ATPase: beta-V279F Deposited 2010-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain 1 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.270
3OFN Structure of four mutant forms of yeast F1 ATPase: alpha-N67I Deposited 2010-08-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.20 Å R-free 0.276
3OFN Structure of four mutant forms of yeast F1 ATPase: alpha-N67I Deposited 2010-08-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain R 2–62（61 aa） Fragment：UNP RESIDUES 2-62	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；5.5% PEG 6000, 10% GLYCEROL, 4% METHANOL, 0.05M SODIUM ACETATE, 0.5MM NICKEL SULPHATE, 0.5MM AMP/PNP, 0.025 MM ADP, 2MM MAGNESIUM CHLORIDE, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.20 Å R-free 0.276
3ZIA The structure of F1-ATPase from Saccharomyces cerevisiae inhibited by its regulatory protein IF1 Deposited 2013-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain S 2–62（61 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 5 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 7.5；296 K；ACTIVE F1-ATPASE (12 MG/ML) WAS EXCHANGED ON A DESALTING COLUMN INTO CRYSTALLISATION BUFFER, PREPARED IN D2O CONSISTING OF 100 MM BIS-TRIS PROPANE, PH 7.5, 100 MM SUCROSE, 1 MM ADP AND 10 MM MAGNESIUM SULPHATE. THEN THE ENZYME WAS INHIBITED AT 23C WITH A 4-FOLD MOLAR EXCESS OF YI1-53 (MUTATION E21A) IN THE PRESENCE OF 1 MM ATP AND 2 MM MAGNESIUM SULPHATE. FURTHER PORTIONS (5 UL OF A NEUTRALISED STOCK SOLUTION CONTAINING 200 MM ATP AND 400 MM MAGNESIUM SULPHATE/ML PROTEIN SOLUTION) WERE ADDED AFTER 5 AND 10 MIN. MORE THAN 95% OF THE ATP HYDROLYSIS ACTIVITY OF THE ENZYME WAS INHIBITED. SODIUM-POTASSIUM TARTRATE WAS ADDED TO 100 MM, AND THE CONCENTRATION OF THE PROTEIN SOLUTION WAS ADJUSTED TO 10 MG/ML WITH CRYSTALLISATION BUFFER. CRYSTALS WERE GROWN AT 23C IN 72 WELL MICRO-BATCH PLATES UNDER FILTERED PARAFFIN OIL. THE CRYSTALLISATION DROPS (4 UL) CONTAINED A 1:1 MIXTURE OF PROTEIN SOLUTION AND PRECIPITANT SOLUTION (20%-26% POLYETHYLENE GLYCOL 3000 AND 600 MM NACL PREPARED IN D2O).	Resolution 2.50 Å R-free 0.262
3ZIA The structure of F1-ATPase from Saccharomyces cerevisiae inhibited by its regulatory protein IF1 Deposited 2013-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 2–62（61 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 5 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 7.5；296 K；ACTIVE F1-ATPASE (12 MG/ML) WAS EXCHANGED ON A DESALTING COLUMN INTO CRYSTALLISATION BUFFER, PREPARED IN D2O CONSISTING OF 100 MM BIS-TRIS PROPANE, PH 7.5, 100 MM SUCROSE, 1 MM ADP AND 10 MM MAGNESIUM SULPHATE. THEN THE ENZYME WAS INHIBITED AT 23C WITH A 4-FOLD MOLAR EXCESS OF YI1-53 (MUTATION E21A) IN THE PRESENCE OF 1 MM ATP AND 2 MM MAGNESIUM SULPHATE. FURTHER PORTIONS (5 UL OF A NEUTRALISED STOCK SOLUTION CONTAINING 200 MM ATP AND 400 MM MAGNESIUM SULPHATE/ML PROTEIN SOLUTION) WERE ADDED AFTER 5 AND 10 MIN. MORE THAN 95% OF THE ATP HYDROLYSIS ACTIVITY OF THE ENZYME WAS INHIBITED. SODIUM-POTASSIUM TARTRATE WAS ADDED TO 100 MM, AND THE CONCENTRATION OF THE PROTEIN SOLUTION WAS ADJUSTED TO 10 MG/ML WITH CRYSTALLISATION BUFFER. CRYSTALS WERE GROWN AT 23C IN 72 WELL MICRO-BATCH PLATES UNDER FILTERED PARAFFIN OIL. THE CRYSTALLISATION DROPS (4 UL) CONTAINED A 1:1 MIXTURE OF PROTEIN SOLUTION AND PRECIPITANT SOLUTION (20%-26% POLYETHYLENE GLYCOL 3000 AND 600 MM NACL PREPARED IN D2O).	Resolution 2.50 Å R-free 0.262
4B2Q Model of the yeast F1Fo-ATP synthase dimer based on subtomogram average Deposited 2012-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain I 2–60（59 aa） Fragment：RESIDUES 2-60 Chain i 2–60（59 aa） Fragment：RESIDUES 2-60	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6 MG MAGNESIUM ION × 10 ADP ADENOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer 250MM TREHALOSE 10NM TRIS- HCL PH7.4；pH 7.4；250MM TREHALOSE 10NM TRIS- HCL PH7.4 cryo-EM vitrification conditions Cryogen ETHANE；VITRIFICATION 1 -- CRYOGEN- ETHANE, TEMPERATURE- 100, INSTRUMENT- HOMEMADE PLUNGER, METHOD- SINGLE SIDE MANUAL BLOTTING FOR 5 SECONDS.,	Resolution 37.00 Å
6CP3 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc with inhibitor of oligomycin bound. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6CP6 Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc. Deposited 2018-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7MD2 The F1 region of ammocidin-bound Saccharomyces cerevisiae ATP synthase Deposited 2021-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain H 2–62（61 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 PO4 PHOSPHATE ION × 1 ZHD (3~{E},5~{Z},7~{E},9~{R},10~{S},11~{E},13~{E},15~{E},17~{R},18~{S},20~{S})-20-[(1~{R})-1-[(2~{S},3~{R},4~{R},5~{S},6~{R})-5-[(2~{S},4~{S},5~{S},6~{R})-5-[(2~{S},4~{R},5~{R},6~{R})-4,6-dimethyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-6-methyl-4-oxidanyl-oxan-2-yl]oxy-3-methoxy-6-(3-methoxypropyl)-5-methyl-2,4-bis(oxidanyl)oxan-2-yl]ethyl]-5,18-dimethoxy-3,7,9,11,13,15-hexamethyl-10-[(2~{R},3~{S},4~{R},5~{R},6~{S})-6-methyl-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-17-oxidanyl-1-oxacycloicosa-3,5,7,11,13,15-hexaen-2-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7MD3 The F1 region of apoptolidin-bound Saccharomyces cerevisiae ATP synthase Deposited 2021-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain H 2–62（61 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 3 PO4 PHOSPHATE ION × 1 ZH7 (3~{E},5~{E},7~{E},9~{R},10~{R},11~{E},13~{E},17~{S},18~{S},20~{S})-18-methoxy-20-[(~{R})-[(2~{R},3~{R},4~{S},5~{R},6~{R})-6-[(2~{R})-3-methoxy-2-[(2~{R},4~{S},5~{S},6~{S})-5-[(2~{S},4~{R},5~{R},6~{R})-4-methoxy-6-methyl-5-oxidanyl-oxan-2-yl]oxy-4,6-dimethyl-4-oxidanyl-oxan-2-yl]oxy-propyl]-3,5-dimethyl-2,4-bis(oxidanyl)oxan-2-yl]-oxidanyl-methyl]-10-[(2~{R},3~{S},4~{S},5~{R},6~{S})-5-methoxy-6-methyl-3,4-bis(oxidanyl)oxan-2-yl]oxy-3,5,7,9,13-pentamethyl-17-oxidanyl-1-oxacycloicosa-3,5,7,11,13-pentaen-2-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.30 Å
7TJY Yeast ATP synthase State 1catalytic(a) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7TJZ Yeast ATP synthase State 1catalytic(b) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK0 Yeast ATP synthase State 1catalytic(c) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TK1 Yeast ATP synthase State 1catalytic(d) without exogenous ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TK2 Yeast ATP synthase State 1binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK3 Yeast ATP synthase State 1binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TK4 Yeast ATP synthase State 1binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.00 Å
7TK5 Yeast ATP synthase State 1binding(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.80 Å
7TK6 Yeast ATP synthase State 1catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TK7 Yeast ATP synthase State 1catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.70 Å
7TK8 Yeast ATP synthase State 1catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.70 Å
7TK9 Yeast ATP synthase State 1catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.00 Å
7TKA Yeast ATP synthase State 1catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKB Yeast ATP synthase State 1catalytic(f) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.30 Å
7TKC Yeast ATP synthase State 1catalytic(g) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 5.80 Å
7TKD Yeast ATP synthase State 1catalytic(h) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.70 Å
7TKE Yeast ATP synthase State 2binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKF Yeast ATP synthase State 2binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKG Yeast ATP synthase State 2catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKH Yeast ATP synthase State 2catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.40 Å
7TKI Yeast ATP synthase State 2catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKJ Yeast ATP synthase State 2catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
7TKK Yeast ATP synthase State 2catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.30 Å
7TKL Yeast ATP synthase State 3binding(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.40 Å
7TKM Yeast ATP synthase State 3binding(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKN Yeast ATP synthase State 3binding(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.10 Å
7TKO Yeast ATP synthase State 3catalytic(a) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.80 Å
7TKP Yeast ATP synthase State 3catalytic(b) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7TKQ Yeast ATP synthase State 3catalytic(c) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
7TKR Yeast ATP synthase State 3catalytic(d) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.50 Å
7TKS Yeast ATP synthase State 3catalytic(e) with 10 mM ATP backbone model Deposited 2022-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–62（61 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.50 Å
8F29 Yeast ATP synthase in conformation-1 at pH 6 Deposited 2022-11-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–60（59 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8F39 Yeast ATP synthase in conformation-2, at pH 6 Deposited 2022-11-09	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–60（59 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8FL8 Yeast ATP Synthase structure in presence of MgATP Deposited 2022-12-21	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain I 2–60（59 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

47 other PDB entries and 59 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATP5E_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain I； PDBConstruct 1–59； UniProt 2–60

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fkj
Deposition date deposition_date	2022-12-21
Structure title title	Yeast ATP Synthase in conformation-3, at pH 6
Keywords keywords	F-type, ATP Synthase, yeast, mitochondrial, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	63.37 Å
Radius of gyration Rg (electron density) rg_electron	63.89 Å
Forward intensity I(0) i0	2629920000.00
Molecular weight molecular_weight	350080.0 kDa
Excluded volume excluded_volume	402150 Å³
Envelope volume envelope_volume	860080 Å³
Hydration-shell volume shell_volume	117210 Å³
Envelope diameter envelope_diameter	225.0 Å
Shell Rg shell_rg	62.63 Å
Envelope Rg envelope_rg	60.80 Å
Shape Rg shape_rg	63.87 Å
Total Rg total_rg	63.90 Å
Total atoms total_atoms	25001
Residues n_residues	5088
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	225.2 Å
Rg (real space) rg_real	63.80 Å
Rg uncertainty (real space) rg_real_error	3.20 Å
I(0) (real space) i0_real	2.6300e+09
I(0) uncertainty (real space) i0_real_error	6.3610e+07
Rg (reciprocal space) rg_reciprocal	62.95 Å
I(0) (reciprocal space) i0_reciprocal	2626000000.0000
Solution quality estimate total_estimate	0.8298
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	63.0 Å
Skewness Skewness skewness	0.462
Kurtosis Kurtosis kurtosis	-0.458
Angular range angular_range	— – 0.1250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	305600000.0000
Real-space data points n_real_points	26
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.692; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.991; Smooth: 0.717

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit 5, mitochondrial
Molecular weight formula_weight	17826.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y
Atom count atom_count	25001

PPPVRLFGVEGTYATALYQAAAKNSSIDAAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVIDAIVETHKNLDGYVVNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEIKGGLIVELG

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit alpha
Molecular weight formula_weight	54748.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C

KAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF

Entity 3 Entity 3 polymer

Description description	ATP synthase subunit beta
Molecular weight formula_weight	50752.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

STPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN

Entity 4 Entity 4 polymer

Description description	ATP synthase subunit 9, mitochondrial
Molecular weight formula_weight	7532.0 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S,T,K,L,M,N,O,P,Q

QLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFG

Entity 5 Entity 5 polymer

Description description	ATP synthase subunit 4, mitochondrial
Molecular weight formula_weight	17576.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

NDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSK

Entity 6 Entity 6 polymer

Description description	ATP synthase subunit d, mitochondrial
Molecular weight formula_weight	19509.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

AKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM

Entity 7 Entity 7 polymer

Description description	ATP synthase subunit H, mitochondrial
Molecular weight formula_weight	10090.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

QDLYLRELKDTKLAPSTLQDAEGNVKPWNPPQKPNLPELELQGPEALKAYTEQNVETAHVAKESEEGESEPIEEDWLVLDDAEETKESH

Entity 8 Entity 8 polymer

Description description	ATP synthase subunit f, mitochondrial
Molecular weight formula_weight	9383.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

VSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAKYFDGDNASGKPLWHFALGIIAFGYSMEYYFH

Entity 9 Entity 9 polymer

Description description	ATP synthase protein 8
Molecular weight formula_weight	5046.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

FYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISK

Entity 10 Entity 10 polymer

Description description	ATP synthase subunit a
Molecular weight formula_weight	25073.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

LTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH

Entity 11 Entity 11 polymer

Description description	ATP18 isoform 1
Molecular weight formula_weight	4145.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNT

Entity 12 Entity 12 polymer

Description description	ATP synthase subunit gamma
Molecular weight formula_weight	29898.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

EVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGA

Entity 13 Entity 13 polymer

Description description	ATP synthase subunit delta, mitochondrial
Molecular weight formula_weight	14080.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

SSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK

Entity 14 Entity 14 polymer

Description description	ATP synthase subunit epsilon, mitochondrial
Molecular weight formula_weight	6388.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.20 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	15189

fit	/app/data/saxs_computation/fk/8fkj/8fkj.fit
pddf	/app/data/pr_computation/fk/8fkj/8fkj.pr.out
profile	/app/data/saxs_computation/fk/8fkj/8fkj.dat

Yeast ATP Synthase in conformation-3, at pH 6

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 5, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit d, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit H, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit f, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase protein 8

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit a

State in the Current Structure

Other States of the Same Protein in the Database

ATP18 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit delta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit epsilon, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer