8g0l

Semi-synthetic CoA-alpha-Synuclein Constructs Trap N-terminal Acetyltransferase NatB for Binding Mechanism Studies

Method: ELECTRON MICROSCOPY D_max: 111.0 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

N-alpha-acetyltransferase 20

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 1–178	Not recorded	N-alpha-acetyltransferase 25, NatB auxiliary subunit × 1 （Q14CX7） Alpha-synuclein × 1 （P37840） CMC CARBOXYMETHYL COENZYME *A × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.39 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8G0L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6VP9 Cryo-EM structure of human NatB complex Deposited 2020-02-02	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–163（163 aa）	Not recorded	CMC CARBOXYMETHYL COENZYME *A × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
7STX Cryo-EM structure of human NatB in complex with CoA-Alpha-Synuclein Deposited 2021-11-15	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–178（178 aa）	Not recorded	COA COENZYME A × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.14 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NAA20_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–178； UniProt 1–178

N-alpha-acetyltransferase 25, NatB auxiliary subunit

Homo sapiens

UniProt Q14CX7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 1–972	Not recorded	N-alpha-acetyltransferase 20 × 1 （P61599） Alpha-synuclein × 1 （P37840） CMC CARBOXYMETHYL COENZYME *A × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.39 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8G0L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6VP9 Cryo-EM structure of human NatB complex Deposited 2020-02-02	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–972（972 aa）	Not recorded	CMC CARBOXYMETHYL COENZYME *A × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
7STX Cryo-EM structure of human NatB in complex with CoA-Alpha-Synuclein Deposited 2021-11-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 45–972（928 aa）	Not recorded	COA COENZYME A × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.14 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NAA25_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–972； UniProt 1–972

Alpha-synuclein

Homo sapiens

UniProt P37840

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 1–5	Fragment：UNP residues 1-5	N-alpha-acetyltransferase 20 × 1 （P61599） N-alpha-acetyltransferase 25, NatB auxiliary subunit × 1 （Q14CX7） CMC CARBOXYMETHYL COENZYME *A × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.39 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8G0L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
10XU Structure of amplified aSyn filament by using seed amplification assay (SAA) from MSA patient CSF. Deposited 2026-02-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 35–101（67 aa） Chain B 35–101（67 aa） Chain C 35–101（67 aa） Chain D 35–101（67 aa） Chain E 35–101（67 aa） Chain U 35–101（67 aa） Chain W 35–101（67 aa） Chain X 35–101（67 aa） Chain Y 35–101（67 aa） Chain Z 35–101（67 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
1XQ8 Human micelle-bound alpha-synuclein Deposited 2004-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–140（140 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298.2 K；Ionic strength (raw mmCIF value) 115；Pressure 1 NMR sample composition 0.5 MM ALPHA-SYNUCLEIN 2H, 13C, 15N	Resolution not provided
2JN5 Solution Structure of a Dodecapeptide from Alpha-Synuclein Bound with Synphilin-1 Deposited 2006-12-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–12（12 aa） Fragment：residues 1-12	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Pressure ambient NMR sample composition 1 mM entity, 20 mM sodium phosphate, 50 mM sodium chloride, 0.1 mM Synphilin-1, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KKW SLAS-micelle bound alpha-synuclein Deposited 2009-06-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–140（140 aa）	Not recorded	No recorded non-water small molecule	Experimental method not declared NMR measurement conditions pH 7.4；298.2 K；Ionic strength (raw mmCIF value) 0.05；Pressure AMBIENT NMR sample composition 0.75 MM [U-100% 13C, U-100% 15N, U-80% 2H] ALPHA-SYNUCLEIN, 75 MM SODIUM LAUROYL SARCOSINATE, 95% H2O/5% D2O	Resolution not provided
2M55 NMR structure of the complex of an N-terminally acetylated alpha-synuclein peptide with calmodulin Deposited 2013-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–19（19 aa） Fragment：UNP residues 1-19	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4	SOLUTION NMR NMR measurement conditions pH 6.36；310 K；Pressure ambient NMR sample composition 600 uM [U-99% 13C; U-99% 15N] calmodulin, 600 uM alpha-synuclein, 50 mM MES, 100 mM potassium chloride, 3 mM calcium ion, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 700 uM [U-13C; U-15N]-Met,Val,Phe,Gly,Leu,Ala alpha-synuclein, 700 uM calmodulin, 50 mM MES, 100 mM potassium chloride, 3 mM calcium ion, 0.1% sodium azide, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 150 uM [U-99% 13C; U-99% 15N] calmodulin, 150 uM alpha-synuclein, 50 mM MES, 100 mM potassium chloride, 3 mM calcium ion, 10 mg/mL Pf1 phage, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
2N0A Atomic-resolution structure of alpha-synuclein fibrils Deposited 2015-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	SOLID-STATE NMR NMR measurement conditions pH 7；Pressure ambient NMR sample composition 66% [U-100% 13C; U-100% 15N] alpha-synuclein, 34% H2O, Rehydrated Fibril \| Rehydrated Fibril NMR sample composition 66% [U-100% 13C 1,3-Glycerol; U-100% 15N] alpha-synuclein, 34% H2O, Rehydrated Fibril \| Rehydrated Fibril NMR sample composition 66% [U-100% 13C 2-Glycerol; U-100% 15N] alpha-synuclein, 34% H2O, Rehydrated Fibril \| Rehydrated Fibril NMR sample composition 66% [U-25% 13C; U-25% 15N] alpha-synuclein, 34% H2O, Rehydrated Fibril \| Rehydrated Fibril NMR sample composition 66% [U-25% 13C 1,3-Glycerol; natural abundance N][natural abundance C13, U-50% N15] alpha-synuclein, 34% H2O, Rehydrated Fibril \| Rehydrated Fibril NMR sample composition 66% [U-25% 13C 2-Glycerol; natural abundance N][natural abundance C13, U-50% N15] alpha-synuclein, 34% H2O, Rehydrated Fibril \| Rehydrated Fibril NMR sample composition 90% Adamantane, 10% KBr, Dry \| Dry	Resolution not provided
2X6M Structure of a single domain camelid antibody fragment in complex with a C-terminal peptide of alpha-synuclein Deposited 2010-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 132–140（9 aa） Fragment：C-TERMINAL FRAGMENT OF ALPHA-SYNUCLEIN, RESIDUES 132-140	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；25% PEG6000, 100 MM HEPES PH 7.5, 100 MM LICL	Resolution 1.62 Å R-free 0.203
3Q25 Crystal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP) Deposited 2010-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–19（19 aa）	Not recorded	SO4 SULFATE ION × 10 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；290 K；2.2 M AMMONIUM SULFATE, 20% (w/v) GLYCEROL, pH 8.0, vapor diffusion, hanging drop, temperature 290K	Resolution 1.90 Å R-free 0.196
3Q25 Crystal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP) Deposited 2010-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–19（19 aa）	Not recorded	SO4 SULFATE ION × 20 GOL GLYCEROL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；290 K；2.2 M AMMONIUM SULFATE, 20% (w/v) GLYCEROL, pH 8.0, vapor diffusion, hanging drop, temperature 290K	Resolution 1.90 Å R-free 0.196
3Q26 Cyrstal structure of human alpha-synuclein (10-42) fused to maltose binding protein (MBP) Deposited 2010-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 10–42（33 aa）	Not recorded	GOL GLYCEROL × 6 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；290 K；0.2M tri-lithium citrate, 2.2 M ammonium sulfate, pH 8.0, vapor diffusion, hanging drop, temperature 290K	Resolution 1.54 Å R-free 0.183
3Q27 Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP) Deposited 2010-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 32–57（26 aa）	Not recorded	SO4 SULFATE ION × 3 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；290 K；0.1M bicine pH 9.0, 2.4 M ammonium sulfate, vapor diffusion, hanging drop, temperature 290K	Resolution 1.30 Å R-free 0.156
3Q28 Cyrstal structure of human alpha-synuclein (58-79) fused to maltose binding protein (MBP) Deposited 2010-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 58–79（22 aa）	Not recorded	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；290 K；0.1M BICINE pH 9.0, 3.2 M AMMONIUM SULFATE, vapor diffusion, hanging drop, temperature 290K	Resolution 1.60 Å R-free 0.173
3Q29 Cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP) Deposited 2010-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–19（19 aa） Chain C 1–19（19 aa）	Not recorded	GOL GLYCEROL × 4 SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；290 K；0.1M TRIS pH 8.0, 2.4 M AMMONIUM SULFATE, vapor diffusion, hanging drop, temperature 290K	Resolution 2.30 Å R-free 0.232
3Q29 Cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP) Deposited 2010-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–19（19 aa） Chain C 1–19（19 aa）	Not recorded	GOL GLYCEROL × 4 SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；290 K；0.1M TRIS pH 8.0, 2.4 M AMMONIUM SULFATE, vapor diffusion, hanging drop, temperature 290K	Resolution 2.30 Å R-free 0.232
4BXL Structure of alpha-synuclein in complex with an engineered binding protein Deposited 2013-07-12	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 35–56（22 aa） Fragment：RESIDUES 35-56	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；303 K；Ionic strength (raw mmCIF value) 0.07；Pressure 1.0 NMR measurement conditions pH 7.4；303 K；Ionic strength (raw mmCIF value) 0.07；Pressure 1.0 NMR sample composition 93% H2O/7% D2O NMR sample composition 93% H2O/7% D2O	Resolution not provided
4R0U Tgvtava, an amyloid forming segment from alpha synuclein, residues 72-78 Deposited 2014-08-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 72–78（7 aa） Fragment：UNP RESIDUES 72-78	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2M magnesium formate, vapor diffusion, hanging drop, temperature 298K	Resolution 1.38 Å R-free 0.217
4R0W Vvtgvta, an amyloid forming segment from alpha synuclein, residues 70-76 Deposited 2014-08-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 70–76（7 aa） Fragment：UNP RESIDUES 70-76	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；isopropanol, sodium cacodylate, pH 6.5, vapor diffusion, hanging drop, temperature 298K	Resolution 1.50 Å R-free 0.274
4RIK Amyloid forming segment, AVVTGVTAV, from the NAC domain of Parkinson's disease protein alpha-synuclein, residues 69-77 Deposited 2014-10-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 69–77（9 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；273 K；0.9M Ammonium Phosphate, 0.1M Sodium Acetate, pH 4.6, vapor diffusion, hanging drop, temperature 273K	Resolution 1.85 Å R-free 0.221
4RIL Structure of the amyloid forming segment, GAVVTGVTAVA, from the NAC domain of Parkinson's disease protein alpha-synuclein, residues 68-78, determined by electron diffraction Deposited 2014-10-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 68–78（11 aa）	Not recorded	No recorded non-water small molecule	ELECTRON CRYSTALLOGRAPHY cryo-EM vitrification conditions Cryogen ETHANE X-ray crystallization conditions batch crystallization；pH 4；310 K；1 mg of synthetic peptide GAVVTGVTAVA was dissolved in 1 ml of sterile water and shaken overnight in an orbital mixing plate, pH 4.0, batch crystallization, temperature 310K	Resolution 1.43 Å R-free 0.275
4ZNN MicroED structure of the segment, GVVHGVTTVA, from the A53T familial mutant of Parkinson's disease protein, alpha-synuclein residues 47-56 Deposited 2015-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 47–56（10 aa）	Mutation：A53T	No recorded non-water small molecule	ELECTRON CRYSTALLOGRAPHY X-ray crystallization conditions BATCH MODE；pH 7；310 K；1 mg of synthetic peptide GVVHGVTTVA was dissolved in 200 microliters of 50 mM phosphate buffer pH 7.0 and 0.1% w/v DMSO and shaken overnight in an orbital mixing plate	Resolution 1.41 Å R-free 0.282
6A6B cryo-em structure of alpha-synuclein fiber Deposited 2018-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 37–99（63 aa） Fragment：UNP residues 37-99 Chain B 37–99（63 aa） Fragment：UNP residues 37-99 Chain C 37–99（63 aa） Fragment：UNP residues 37-99 Chain D 37–99（63 aa） Fragment：UNP residues 37-99 Chain E 37–99（63 aa） Fragment：UNP residues 37-99 Chain F 37–99（63 aa） Fragment：UNP residues 37-99 Chain G 37–99（63 aa） Fragment：UNP residues 37-99 Chain H 37–99（63 aa） Fragment：UNP residues 37-99 Chain I 37–99（63 aa） Fragment：UNP residues 37-99 Chain J 37–99（63 aa） Fragment：UNP residues 37-99 Chain K 37–99（63 aa） Fragment：UNP residues 37-99 Chain L 37–99（63 aa） Fragment：UNP residues 37-99	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.07 Å
6CU7 Alpha Synuclein fibril formed by full length protein - Rod Polymorph Deposited 2018-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 3 cryo-EM vitrification conditions Cryogen ETHANE；blot force: 1 blot time: 4s	Resolution 3.50 Å
6CU8 Alpha Synuclein fibril formed by full length protein - Twister Polymorph Deposited 2018-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 3 cryo-EM vitrification conditions Cryogen ETHANE；blot force: 1 blot time: 4s	Resolution 3.60 Å
6H6B Structure of alpha-synuclein fibrils Deposited 2018-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–121（121 aa） Chain B 1–121（121 aa） Chain C 1–121（121 aa） Chain D 1–121（121 aa） Chain E 1–121（121 aa） Chain F 1–121（121 aa） Chain G 1–121（121 aa） Chain H 1–121（121 aa） Chain I 1–121（121 aa） Chain J 1–121（121 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6I42 Structure of the alpha-Synuclein PreNAC/Cyclophilin A-complex Deposited 2018-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 48–60（13 aa） Fragment：UNP residues 48-60	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；1.93 M tri-ammonium citrate, pH 7.0	Resolution 1.38 Å R-free 0.178
6L1T Cryo-EM structure of phosphorylated Tyr39 a-synuclein amyloid fibril Deposited 2019-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.22 Å
6L1U Cryo-EM structure of phosphorylated Tyr39 alpha-synuclein amyloid fibril Deposited 2019-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
6L4S cryo-em structure of alpha-synuclein fiber mutation type E46K Deposited 2019-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 45–99（55 aa） Chain B 45–99（55 aa） Chain C 45–99（55 aa） Chain D 45–99（55 aa） Chain E 45–99（55 aa） Chain F 45–99（55 aa）	Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
6LRQ Cryo-EM structure of A53T alpha-synuclein amyloid fibril Deposited 2020-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.49 Å
6OSJ Cryo-EM structure of the N-terminally acetylated full length alpha-synuclein fibrils (Ac1-140) Deposited 2019-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
6OSL Cryo-EM structure of the N-terminally acetylated C-terminal Alpha-synuclein truncation Ac1-122 Deposited 2019-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
6OSM Cryo-EM structure of the N-terminally acetylated C-terminal Alpha-synuclein truncation Ac1-103 Deposited 2019-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6PEO Cryo-EM structure of alpha-synuclein H50Q Narrow Fibril Deposited 2019-06-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6PES Cryo-EM structure of alpha-synuclein H50Q Wide Fibril Deposited 2019-06-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain V 1–140（140 aa） Chain W 1–140（140 aa） Chain X 1–140（140 aa） Chain Y 1–140（140 aa） Chain Z 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6RT0 cryo-em structure of alpha-synuclein fibril polymorph 2A Deposited 2019-05-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL aliquots were applied onto second glow-discharged 300 mesh copper Quantifoil grids R2 1	Resolution 3.10 Å
6RTB cryo-em structure of alpha-synuclein fibril polymorph 2B Deposited 2019-05-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL aliquots were applied onto second glow-discharged 300 mesh copper Quantifoil grids R2 1	Resolution 3.46 Å
6SST cryo-em structure of alpha-synuclein fibril polymorph 2B Deposited 2019-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL aliquots were applied onto second glow-discharged 300 mesh copper Quantifoil grids R2 1	Resolution 3.40 Å
6SSX cryo-em structure of alpha-synuclein fibril polymorph 2A Deposited 2019-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL aliquots were applied onto second glow-discharged 300 mesh copper Quantifoil grids R2 1	Resolution 2.98 Å
6UFR Structure of recombinantly assembled E46K alpha-synuclein fibrils Deposited 2019-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
6XYO Multiple system atrophy Type I alpha-synuclein filament Deposited 2020-01-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
6XYP Multiple system atrophy Type II-1 alpha-synuclein filament Deposited 2020-01-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
6XYQ Multiple system atrophy Type II-2 alpha-synuclein filament Deposited 2020-01-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
7C1D Cryo-EM structure of the hE46K cross-seeded hWT alpha-synuclein fibril Deposited 2020-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7E0F CryoEM structure of G51D alpha-synuclein amyloid fibril Deposited 2021-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Mutation：G51D Mutation：G51D Mutation：G51D Mutation：G51D Mutation：G51D Mutation：G51D	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.02 Å
7L7H Alpha-synuclein fibrils Deposited 2020-12-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.00 Å
7LC9 Cryo-EM structure of the N-terminal alpha-synuclein truncation 41-140 Deposited 2021-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 41–140（100 aa） Chain B 41–140（100 aa） Chain C 41–140（100 aa） Chain D 41–140（100 aa） Chain E 41–140（100 aa） Chain F 41–140（100 aa） Chain G 41–140（100 aa） Chain H 41–140（100 aa） Chain I 41–140（100 aa） Chain J 41–140（100 aa） Chain K 41–140（100 aa） Chain L 41–140（100 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7NCA Type 1A alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 2 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.47 Å
7NCA Type 1A alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 2 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.47 Å
7NCG Type 2A alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 2 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.43 Å
7NCG Type 2A alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 2 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.43 Å
7NCH Type 1B alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.84 Å
7NCH Type 1B alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.84 Å
7NCI Type 2B alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.55 Å
7NCI Type 2B alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.55 Å
7NCJ Type 2AB alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 4.23 Å
7NCJ Type 2AB alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 4.23 Å
7NCK Type 3 alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 5 Deposited 2021-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；LMB vitrobot IV	Resolution 3.18 Å
7OZG PMCA-amplified alpha-synuclein fibril polymorph, Parkinson's Disease patient-derived seeds Deposited 2021-06-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7OZH PMCA-amplified alpha-synuclein fibril polymorph, Multiple System Atrophy patient-derived seeds Deposited 2021-06-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.02 Å
7STX Cryo-EM structure of human NatB in complex with CoA-Alpha-Synuclein Deposited 2021-11-15	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–5（5 aa） Fragment：UNP residues 1-5	Non-standard monomer：Yes (specific site not provided by mmCIF)	COA COENZYME A × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.14 Å
7UAK Structure of recombinantly assembled A53E alpha-synuclein fibrils Deposited 2022-03-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Mutation：A53E Mutation：A53E Mutation：A53E Mutation：A53E Mutation：A53E Mutation：A53E	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
7V47 Type 1A alpha-synuclein fibril seeded by cerebrospinal fluid from a preclinical Parkinson's disease patient Deposited 2021-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7V48 Type 1D alpha-synuclein fibril seeded by cerebrospinal fluid from a postmortal Parkinson's disease patient Deposited 2021-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7V49 Type 4 alpha-synuclein fibril seeded by cerebrospinal fluid from a postmortal Parkinson's disease patient Deposited 2021-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7V4A Heparin-induced alpha-synuclein fibrils polymorph 1 Deposited 2021-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7V4B Heparin-induced alpha-synuclein fibrils polymorph 3 Deposited 2021-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7V4C Heparin-induced alpha-synuclein fibrils polymorph 4 Deposited 2021-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7V4D Heparin-remodelled alpha-synuclein fibrils Deposited 2021-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7WMM alpha-synuclein fibril-F0502B complex Deposited 2022-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	1KI 2-bromanyl-4-[(~{E})-2-[6-[2-(2-fluoranylethoxy)ethyl-methyl-amino]-5-methyl-1,3-benzothiazol-2-yl]ethenyl]phenol × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
7WNZ CryoEM structure of human alpha-synuclein A53T fibril Deposited 2022-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 36–100（65 aa） Chain B 36–100（65 aa） Chain C 36–100（65 aa） Chain D 36–100（65 aa） Chain E 36–100（65 aa） Chain F 36–100（65 aa） Chain G 36–100（65 aa） Chain H 36–100（65 aa） Chain I 36–100（65 aa） Chain J 36–100（65 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7WO0 CryoEM structure of human alpha-synuclein A53T fibril induced by calcium ions Deposited 2022-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 35–99（65 aa） Chain B 35–99（65 aa） Chain C 35–99（65 aa） Chain D 35–99（65 aa） Chain E 35–99（65 aa） Chain F 35–99（65 aa） Chain G 35–99（65 aa） Chain O 35–99（65 aa） Chain P 35–99（65 aa） Chain Q 35–99（65 aa） Chain R 35–99（65 aa） Chain S 35–99（65 aa） Chain T 35–99（65 aa） Chain U 35–99（65 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
7XJX The cryo-EM structure of Fe3+ induced alpha-syn fibril. Deposited 2022-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
7XO0 Minor polymorph inalpha-synuclein fibril seeded by cerebrospinal fluid from a mid-to-late stage (mid-PD-1) Parkinson's disease patient Deposited 2022-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7XO1 Major polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a mid-to-late stage (mid-PD-1) Parkinson's disease patient Deposited 2022-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7XO2 Minor polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a mid-to-late stage (mid-PD-4) Parkinson's disease patient Deposited 2022-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain I 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7XO3 Type 1C alpha-synuclein fibril seeded by cerebrospinal fluid from a mid-to-late stage (mid-PD-4) Parkinson's disease patient Deposited 2022-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
7YK2 Cryo-EM structure of Apo-alpha-syn fibril Deposited 2022-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7YK8 Cryo-EM structure of dLAG3-alpha-syn fibril Deposited 2022-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7YNF CCA-bound alpha-synuclein fibrils Deposited 2022-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	V79 copper;trisodium;18-(2-carboxylatoethyl)-20-(carboxylatomethyl)-12-ethenyl-7-ethyl-3,8,13,17-tetramethyl-17,18-dihydroporphyrin-21,23-diide-2-carboxylate × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
7YNG CR-bound alpha-synuclein fibrils Deposited 2022-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7YNL EB-bound alpha-synuclein fibrils Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Not recorded	IZ8 4-azanyl-6-[[4-[4-[(~{E})-(8-azanyl-1-oxidanyl-5,7-disulfo-naphthalen-2-yl)diazenyl]-3-methyl-phenyl]-2-methyl-phenyl]diazenyl]-5-oxidanyl-naphthalene-1,3-disulfonic acid × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
7YNM ThT-bound alpha-synuclein fibrils conformation 1 Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	TFX 2-[4-(dimethylamino)phenyl]-3,6-dimethyl-1,3-benzothiazol-3-ium × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7YNN ThT-bound alpha-synuclein fibrils conformation 2 Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	TFX 2-[4-(dimethylamino)phenyl]-3,6-dimethyl-1,3-benzothiazol-3-ium × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7YNO PiB-bound alpha-synuclein fibrils conformation 1 Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	IZV 2-[4-(methylamino)phenyl]-1,3-benzothiazol-6-ol × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7YNP BF227-bound alpha-synuclein fibrils Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	IZM 5-[(~{E})-2-(6-methoxy-1,3-benzoxazol-2-yl)ethenyl]-~{N},~{N}-dimethyl-1,3-thiazol-2-amine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7YNQ PiB-bound alpha-synuclein fibrils conformation 2 Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	IZV 2-[4-(methylamino)phenyl]-1,3-benzothiazol-6-ol × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7YNR C05-03-bound alpha-synuclein fibrils Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7YNS SIL5-bound alpha-synuclein fibrils Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7YNT pFTAA-bound alpha-synuclein fibrils Deposited 2022-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8A4L Lipidic alpha-synuclein fibril - polymorph L2A Deposited 2022-06-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.68 Å
8A9L Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease and dementia with Lewy bodies Deposited 2022-06-28	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: Trimeric	Chain A 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
8ADS Lipidic alpha-synuclein fibril - polymorph L2B Deposited 2022-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.05 Å
8ADU Lipidic alpha-synuclein fibril - polymorph L1A Deposited 2022-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.24 Å
8ADV Lipidic alpha-synuclein fibril - polymorph L1B Deposited 2022-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å
8ADW Lipidic alpha-synuclein fibril - polymorph L1C Deposited 2022-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
8AEX Lipidic alpha-synuclein fibril - polymorph L3A Deposited 2022-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.76 Å
8BQV Cryo-EM structure of alpha-synuclein singlet filament from Juvenile-onset synucleinopathy Deposited 2023-01-18	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: Decameric	Chain A 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.00 Å
8BQW Cryo-EM structure of alpha-synuclein filaments doublet from Juvenile-onset synucleinopathy Deposited 2023-01-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: Eicosameric	Chain A 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.30 Å
8CE7 Type1 alpha-synuclein filament assembled in vitro by wild-type and mutant (7 residues insertion) protein Deposited 2023-02-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: Hexameric	Chain A 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8CEB Type2 alpha-synuclein filament assembled in vitro by wild-type and mutant (7 residues insertion) protein Deposited 2023-02-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8CYR Alpha-synuclein fibril from spontaneous control Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8CYS CryoEM structures of amplified alpha-synuclein fibril class B type II with extended core from DLB case I Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8CYT CryoEM structures of amplified alpha-synuclein fibril class A type I with extended core from DLB case I Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8CYV CryoEM structures of amplified alpha-synuclein fibril class B mixed type I/II with extended core from DLB case II Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8CYW CryoEM structures of amplified alpha-synuclein fibril class B type I with compact core from DLB case III Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8CYX CryoEM structure of amplified alpha-synuclein fibril class A type I with compact core from DLB case III Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8CYY CryoEM structure of amplified alpha-synuclein fibril class B mixed type I/II with extended core from DLB case V Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8CZ0 CryoEM structure of amplified alpha-synuclein fibril class B type I with extended core from DLB case VII Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8CZ1 CryoEM structure of amplified alpha-synuclein fibril class B type II with extended core from DLB case VII Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8CZ2 CryoEM structure of amplified alpha-synuclein fibril class A type I with extended core from DLB case VII Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8CZ3 CryoEM structure of amplified alpha-synuclein fibril class B type I with extended core from DLB case X Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8CZ6 CryoEM structure of amplified alpha-synuclein fibril class A type I with extended core from DLB case X Deposited 2022-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Gibco Cat # 10010072 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8FPT STRUCTURE OF ALPHA-SYNUCLEIN FIBRILS DERIVED FROM HUMAN LEWY BODY DEMENTIA TISSUE Deposited 2023-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	SOLID-STATE NMR NMR measurement conditions pH 7.6；273 K；Ionic strength (raw mmCIF value) 100 mM NACL；Pressure AMBIENT NMR sample composition 66 % [U-100% 13C; U-100% 15N] ALPHA-SYNUCLEIN, 34% H2O \| 34% H2O NMR sample composition 66 % [U-100% 2H; U-100% 13C; U-100% 15N] ALPHA-SYNUCLEIN, 34% H2O, BACK-EXCHANGED IN 99.8% D2O \| 34% H2O, BACK-EXCHANGED IN 99.8% D2O NMR sample composition 20 % [U-25% 2-13C GLYCEROL; U-100% 15N] labelled ALPHA-SYNUCLEIN, 80 % ALPHA-SYNUCLEIN, H2O \| H2O	Resolution not provided
8GF7 Cryo-EM structure of serine 87 O-GlcNAc-modified alpha-synuclein fibrils Deposited 2023-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 7–96（90 aa） Chain B 7–96（90 aa） Chain C 7–96（90 aa） Chain D 7–96（90 aa） Chain E 7–96（90 aa） Chain F 7–96（90 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；normal PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
8H03 Major polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a preclinical Parkinson's disease patient Deposited 2022-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8H04 Major polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a postmortal Parkinson's disease patient Deposited 2022-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8H05 Minor polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a postmortal Parkinson's disease patient Deposited 2022-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8HZB Formed alpha-synuclein fibrils after incubation with heparin for 1 hour (Hep-remod-1) Deposited 2023-01-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8HZC Formed alpha-synuclein fibrils after incubation with heparin for 1 hour (Hep-remod-2) Deposited 2023-01-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8HZS Formed alpha-synuclein fibrils after incubation with heparin for 3 days (Hep-remod-3) Deposited 2023-01-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8JEX Cryo-EM structure of alpha-synuclein gS87 fibril Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain K 1–140（140 aa） Chain P 1–140（140 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8JEY Cryo-EM structure of alpha-synuclein pS87 fibril Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
8JJV Structure of truncated form of nanobody in complex with alpha-synuclein peptide Deposited 2023-05-31	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 43–56（14 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M BIS-TRIS pH 5.5, 2.0M ammonium sulfate	Resolution 1.23 Å R-free 0.170
8JLY Structure of nanobody in complex with alpha-synuclein peptide Deposited 2023-06-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 43–56（14 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium acetate trihydrate pH 4.6, 2.0M ammonium sulfate	Resolution 1.29 Å R-free 0.186
8OG0 Crystal structure of MJF14-6-4-2 Fab fragment in complex with epitope peptide Deposited 2023-03-17	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 136–140（5 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；Sitting droplets were set up by mixing 1 ul of Fab fragments, 0.5 ul of peptide (1 mg/ml in 20 mM tris-HCl) and 1 ul crystallization buffer (24% PEG 6000, 0.1M Na-citrate pH 5.0).	Resolution 1.71 Å R-free 0.231
8OQI Cryo-EM structure of the wild-type alpha-synuclein fibril. Deposited 2023-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8PIX Cryo EM structure of the type 3C polymorph of alpha-synuclein at low pH. Deposited 2023-06-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5.8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.41 Å
8PJO Cryo EM structure of the type 3D polymorph of alpha-synuclein E46K mutant at low pH. Deposited 2023-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K	CL CHLORIDE ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 5.8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.31 Å
8PK2 Cryo EM structure of the type 1m polymorph of alpha-synuclein Deposited 2023-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.26 Å
8PK4 Cryo EM structure of the type 5A polymorph of alpha-synuclein. Deposited 2023-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.30 Å
8QPZ CryoEM structure of recombinant DeltaN7 alpha-synuclein in PBS Deposited 2023-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain A 8–140（133 aa） Chain B 8–140（133 aa） Chain C 8–140（133 aa） Chain D 8–140（133 aa） Chain E 8–140（133 aa） Chain F 8–140（133 aa） Chain G 8–140（133 aa） Chain H 8–140（133 aa） Chain I 8–140（133 aa） Chain J 8–140（133 aa） Chain K 8–140（133 aa） Chain L 8–140（133 aa）	Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression) Mutation：deltaN7 (methionine kept for expression)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 8.1 mM Na2HPO4 and 1.5 mM KH2PO4; pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8RI9 Late alpha-Synuclein fibril structure from liquid-liquid phase separations. Deposited 2023-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8RQM Alpha-synuclein amyloid fibrils Deposited 2024-01-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8RRR Alpha-synuclein amyloid fibril Deposited 2024-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8X7B ThT-bound E46K alpha-synuclein fibrils Deposited 2023-11-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	TFX 2-[4-(dimethylamino)phenyl]-3,6-dimethyl-1,3-benzothiazol-3-ium × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8X7L EB-bound E46K alpha-synuclein fibrils Deposited 2023-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	IZ8 4-azanyl-6-[[4-[4-[(~{E})-(8-azanyl-1-oxidanyl-5,7-disulfo-naphthalen-2-yl)diazenyl]-3-methyl-phenyl]-2-methyl-phenyl]diazenyl]-5-oxidanyl-naphthalene-1,3-disulfonic acid × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8X7M CR-bound E46K alpha-synuclein fibrils Deposited 2023-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	CGO sodium 3,3'-(1E,1'E)-biphenyl-4,4'-diylbis(diazene-2,1-diyl)bis(4-aminonaphthalene-1-sulfonate) × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8X7O PiB-bound E46K mutanted alpha-synuclein fibrils Deposited 2023-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K Mutation：E46K	IZV 2-[4-(methylamino)phenyl]-1,3-benzothiazol-6-ol × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8X7P CCA-bound E46K alpha-synuclein fibrils Deposited 2023-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	V79 copper;trisodium;18-(2-carboxylatoethyl)-20-(carboxylatomethyl)-12-ethenyl-7-ethyl-3,8,13,17-tetramethyl-17,18-dihydroporphyrin-21,23-diide-2-carboxylate × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8X7Q pFTAA-bound E46K alpha-synuclein fibrils Deposited 2023-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	3LS 3''',4'-bis(carboxymethyl)-2,2':5',2'':5'',2''':5''',2''''-quinquethiophene-5,5''''-dicarboxylic acid × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8X7R C05-03-bound E46K alpha-synuclein fibrils Deposited 2023-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	Y9W 2-[(~{E})-4-[6-(methylamino)pyridin-3-yl]but-1-en-3-ynyl]-1,3-benzothiazol-6-ol × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8XWD Croy-EM structure of alpha synuclein fibril with EGCG Deposited 2024-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	KDH (2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl 3,4,5-trihydroxybenzoate × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8Y2P The cryo-EM structure of a-synuclein fibril in Tris buffer. Deposited 2024-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8Y2Q The cryo-EM structure of spermine induced a-synuclein fibril in Tris buffer. Deposited 2024-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8ZLI BTA-2-bound E46K alpha-synuclein fibrils Deposited 2024-05-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 45–99（55 aa） Chain B 45–99（55 aa） Chain C 45–99（55 aa） Chain D 45–99（55 aa） Chain E 45–99（55 aa） Chain F 45–99（55 aa） Chain I 45–99（55 aa） Chain J 45–99（55 aa） Chain K 45–99（55 aa） Chain L 45–99（55 aa）	Not recorded	A1L13 ~{N},~{N}-dimethyl-4-(6-methyl-1,3-benzothiazol-2-yl)aniline × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8ZLO F0502B-bound E46K alpha-synuclein fibril Deposited 2024-05-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain A 45–99（55 aa） Chain B 45–99（55 aa） Chain C 45–99（55 aa） Chain D 45–99（55 aa） Chain E 45–99（55 aa） Chain F 45–99（55 aa） Chain G 45–99（55 aa） Chain H 45–99（55 aa） Chain I 45–99（55 aa） Chain J 45–99（55 aa） Chain O 45–99（55 aa） Chain T 45–99（55 aa）	Not recorded	1KI 2-bromanyl-4-[(~{E})-2-[6-[2-(2-fluoranylethoxy)ethyl-methyl-amino]-5-methyl-1,3-benzothiazol-2-yl]ethenyl]phenol × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8ZLP apo WT polymorph 5a alpha-synuclein fibril Deposited 2024-05-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–98（98 aa） Chain B 1–98（98 aa） Chain C 1–98（98 aa） Chain F 1–98（98 aa） Chain G 1–98（98 aa） Chain H 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8ZMY F0502B-bound WT polymorph 5a alpha-synuclein fibril Deposited 2024-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain A 1–98（98 aa） Chain B 1–98（98 aa） Chain C 1–98（98 aa） Chain D 1–98（98 aa） Chain E 1–98（98 aa） Chain F 1–98（98 aa） Chain G 1–98（98 aa） Chain H 1–98（98 aa） Chain I 1–98（98 aa） Chain J 1–98（98 aa） Chain K 1–98（98 aa） Chain L 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	1KI 2-bromanyl-4-[(~{E})-2-[6-[2-(2-fluoranylethoxy)ethyl-methyl-amino]-5-methyl-1,3-benzothiazol-2-yl]ethenyl]phenol × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8ZVY Alpha-Synuclein with H2a-H2b dimer complex structure. Deposited 2024-06-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 121–140（20 aa） Chain D 121–140（20 aa）	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；291.15 K；100 mM Tris pH 8.0 and 10% PEG 8000.	Resolution 1.72 Å R-free 0.220
8ZWH Heparin bound E46K alpha-synuclein fibril Deposited 2024-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8ZWI Chondroitin sulfate bound alpha-synuclein fibril Deposited 2024-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8ZWJ Polyadenylic acid bound alpha-synuclein fibril Polymorph 1 Deposited 2024-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain G 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8ZWK Polyadenylic acid bound alpha-synuclein fibril Polymorph 2 Deposited 2024-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9C5R Structure of recombinantly assembled alpha-synuclein variant fibrils Deposited 2024-06-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.61 Å
9CD9 Structure of type II-2 alpha-synuclein filament from multiple system atrophy Deposited 2024-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa） Chain Q 1–140（140 aa） Chain R 1–140（140 aa） Chain S 1–140（140 aa） Chain T 1–140（140 aa） Chain U 1–140（140 aa） Chain V 1–140（140 aa） Chain W 1–140（140 aa） Chain X 1–140（140 aa） Chain Y 1–140（140 aa） Chain Z 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Wait time 30s, blot time 7.5s	Resolution 3.20 Å
9CDA Structure of type I-2 alpha-synuclein filament from multiple system atrophy Deposited 2024-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: 18-meric	Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa） Chain Q 1–140（140 aa） Chain R 1–140（140 aa） Chain S 1–140（140 aa） Chain T 1–140（140 aa） Chain U 1–140（140 aa） Chain V 1–140（140 aa） Chain W 1–140（140 aa） Chain X 1–140（140 aa） Chain Y 1–140（140 aa） Chain Z 1–140（140 aa） Chain a 1–140（140 aa） Chain b 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Wait time 30s, blot time 7.5s	Resolution 3.30 Å
9CK3 Cryo-EM structure of in-vitro alpha-synuclein fibril Deposited 2024-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.04 Å
9CKK Cryo-EM structure of acetylated alpha-synuclein A53T fibril - polymorph A Deposited 2024-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.21 Å
9CKL Cryo-EM structure of acetylated alpha-synuclein A53T fibril - polymorph B Deposited 2024-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；Dulbecco's Phosphate Buffered Saline without calcium chloride and magnesium chloride cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.68 Å
9CX6 Cryo-EM filament structure in FTLD-synuclein Deposited 2024-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9CX6 Cryo-EM filament structure in FTLD-synuclein Deposited 2024-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9D5C Cryo-EM structure of serine 87 O-GlcNAc-modified alpha-synuclein fibrils Deposited 2024-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–96（96 aa） Chain B 1–96（96 aa） Chain C 1–96（96 aa） Chain F 1–96（96 aa） Chain G 1–96（96 aa） Chain H 1–96（96 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；normal PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
9E8U (Apo)Alpha-synuclein fibril structures from MSA patient brain Deposited 2024-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；30mM Tris-HCl, pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9E8V Complex fibril structure of MSA alpha-synuclein with CNS-11g at 4 hours Deposited 2024-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	A1BGB 2-(4-benzyl-1-oxophthalazin-2(1H)-yl)-N-(2,6-dimethylphenyl)acetamide × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；30mM Tris-HCl, pH 7.4, with 1% DMSO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9E8W Complex fibril structure of MSA alpha-synuclein with CNS-11g at 6 hours Deposited 2024-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	A1BGB 2-(4-benzyl-1-oxophthalazin-2(1H)-yl)-N-(2,6-dimethylphenyl)acetamide × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；30mM Tris-HCl, pH 7.4, with 1% DMSO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9E8X Complex fibril structure of MSA alpha-synuclein with CNS-11g at 10 hours Deposited 2024-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	A1BGB 2-(4-benzyl-1-oxophthalazin-2(1H)-yl)-N-(2,6-dimethylphenyl)acetamide × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；30mM Tris-HCl, pH 7.4, with 1% DMSO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9E8Y Complex fibril structure of MSA alpha-synuclein with CNS-11g at 15 hours Deposited 2024-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	A1BGB 2-(4-benzyl-1-oxophthalazin-2(1H)-yl)-N-(2,6-dimethylphenyl)acetamide × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；30mM Tris-HCl, pH 7.4, with 1% DMSO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9E9X Cryo-EM structure of alpha-synuclein filaments derived from the temporal cortex of the case of atypical multiple system atrophy Deposited 2024-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9EUU Structure of recombinant alpha-synuclein fibrils 1B capable of seeding GCIs in vivo Deposited 2024-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: 18-meric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa） Chain Q 1–140（140 aa） Chain R 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；NaCl 100 mM, TRIS 20mM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.93 Å
9FYP Cryo EM structure of the type 3B polymorph of alpha-synuclein at low pH. Deposited 2024-07-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa） Chain Q 1–140（140 aa） Chain R 1–140（140 aa）	Not recorded	CL CHLORIDE ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 5.8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.23 Å
9HC6 The L2A-I alpha-synuclein fibril in the presence of MODAG-005 (short incubation) Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: 15-meric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
9HC7 The L2A-II alpha-synuclein fibril in the presence of MODAG-005 (short incubation) Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: 15-meric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9HC8 The L2C alpha-synuclein fibril in the presence of MODAG-005 (short incubation) Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.82 Å
9HC9 The L2A-I alpha-synuclein fibril in the presence of MODAG-005 (long incubation) Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: 15-meric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.76 Å
9HCA The L2A-II alpha-synuclein fibril in the presence of MODAG-005 (long incubation) Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: 15-meric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9HCB The L2C alpha-synuclein fibril in the presence of MODAG-005 (long incubation) Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9HGR In vitro grown WT Alpha-Synuclein Fibrils Deposited 2024-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–140（140 aa） Chain B 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.70 Å
9HGS In vitro grown G14R Alpha-Synuclein Fibrils Deposited 2024-11-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
9HXA In vitro grown K58N Alpha-Synuclein Fibrils Deposited 2025-01-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
9IC7 Cryo-EM structure of alpha-synuclein fibrils formed in artificial cerebrospinal fluid (aCSF) Deposited 2025-02-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: 14-meric	Chain a 1–140（140 aa） Chain b 1–140（140 aa） Chain c 1–140（140 aa） Chain d 1–140（140 aa） Chain e 1–140（140 aa） Chain f 1–140（140 aa） Chain g 1–140（140 aa） Chain h 1–140（140 aa） Chain i 1–140（140 aa） Chain j 1–140（140 aa） Chain k 1–140（140 aa） Chain l 1–140（140 aa） Chain m 1–140（140 aa） Chain n 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.33；Once all components were mixed together, the pH was adjusted by supplementing 1.6 microliters of 25% HCl to yield pH of 7.33. cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.90 Å
9IJP Polyphosphate bound alpha-synuclein fibril Deposited 2024-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain E 1–140（140 aa） Chain G 1–140（140 aa） Chain I 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	7TT Tetraphosphate × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9JBY The cryo-EM structure of Ac-K58W_G51DA53T a-syn fibril. Deposited 2024-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 37–98（62 aa） Chain B 37–98（62 aa） Chain C 37–98（62 aa） Chain D 37–98（62 aa） Chain E 37–98（62 aa） Chain F 37–98（62 aa）	Mutation：G51D,A53T,K58W Mutation：G51D,A53T,K58W Mutation：G51D,A53T,K58W Mutation：G51D,A53T,K58W Mutation：G51D,A53T,K58W Mutation：G51D,A53T,K58W	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.49 Å
9JC3 The cryo-EM structure of Ac-G51DA53T P1 a-syn fibril. Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.39 Å
9JC4 The cryo-EM structure of Ac-G51DA53T P2 a-syn fibril. Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9JC5 The cryo-EM structure of Ac-G51DA53T P3 a-syn fibril. Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
9JD7 The cryo-EM structure of Ac-G51DA53T a-syn fibril. Deposited 2024-08-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.57 Å
9JD8 The cryo-EM structure of Ac-G51DA53T P5 a-syn fibril. Deposited 2024-08-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 9 PDB declaration: nonameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
9JDK The cryo-EM structure of Ac-G51DA53T P6 a-syn fibril. Deposited 2024-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 37–99（63 aa） Chain B 37–99（63 aa） Chain C 37–99（63 aa） Chain D 37–99（63 aa） Chain E 37–99（63 aa） Chain F 37–99（63 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
9JE2 The cryo-EM structure of Ac-K58N_G51DA53T a-syn fibril. Deposited 2024-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Mutation：K58N,G51D,A53T Mutation：K58N,G51D,A53T Mutation：K58N,G51D,A53T Mutation：K58N,G51D,A53T Mutation：K58N,G51D,A53T Mutation：K58N,G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.06 Å
9JE4 The cryo-EM structure of Ac-E57A_G51DA53T a-syn fibril. Deposited 2024-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa）	Mutation：E57A,G51D,A53T Mutation：E57A,G51D,A53T Mutation：E57A,G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
9JE6 The cryo-EM structure of Ac-G51DA53T low salt a-syn fibril. Deposited 2024-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.43 Å
9JE7 The cryo-EM structure of Ac-E57Q_G51DA53T a-syn fibril. Deposited 2024-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–140（140 aa） Chain C 1–140（140 aa） Chain E 1–140（140 aa）	Mutation：E57Q,G51D,A53T Mutation：E57Q,G51D,A53T Mutation：E57Q,G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.36 Å
9JE8 The cryo-EM structure of Ac-G51DA53T 30days a-syn fibril. Deposited 2024-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9JI8 Cryo-EM structure of alpha-synuclein-H21 fibril Deposited 2024-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain F 37–99（63 aa） Fragment：UNP residues 37-99 Chain G 37–99（63 aa） Fragment：UNP residues 37-99 Chain K 37–99（63 aa） Fragment：UNP residues 37-99 Chain L 37–99（63 aa） Fragment：UNP residues 37-99 Chain M 37–99（63 aa） Fragment：UNP residues 37-99 Chain O 37–99（63 aa） Fragment：UNP residues 37-99	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9JKE The cryo-EM structure of Ac-K58W_G51DA53T P2 a-syn fibril. Deposited 2024-09-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 37–98（62 aa） Chain B 37–98（62 aa） Chain C 37–98（62 aa） Chain D 37–98（62 aa） Chain E 37–98（62 aa） Chain F 37–98（62 aa）	Mutation：K58W,G51D,A53T Mutation：K58W,G51D,A53T Mutation：K58W,G51D,A53T Mutation：K58W,G51D,A53T Mutation：K58W,G51D,A53T Mutation：K58W,G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9JO6 The complex of alpha-synuclein in the presence of PD6 Deposited 2024-09-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–140（140 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；283.15 K；Ionic strength (raw mmCIF value) 0.1627；Pressure 1 NMR measurement conditions pH 7.5；283.15 K；Ionic strength (raw mmCIF value) 0.1627；Pressure 1 NMR sample composition 0.50 mM [U-100% 13C; U-100% 15N] alpha-synuclein, 1.00 mM PD6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.20 mM alpha-synuclein, 0.40 mM [U-100% 13C; U-100% 15N] PD6, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
9K7Q Parkinson disease protein 7 (DJ-1) and Alpha-synuclein (Alpha-syn) complex Deposited 2024-10-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain M 1–92（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2 M Sodium iodide, 20% w/v Polyethylene glycol 3,350, pH 7.0	Resolution 4.58 Å R-free 0.222
9KA3 The cryo-EM structure of Ac-K58D_G51DA53T a-syn fibril. Deposited 2024-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Mutation：K58D,G51D,A53T Mutation：K58D,G51D,A53T Mutation：K58D,G51D,A53T Mutation：K58D,G51D,A53T Mutation：K58D,G51D,A53T Mutation：K58D,G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.72 Å
9KA4 The cryo-EM structure of MSA-like fold (P1) formed under the palette stratagy. Deposited 2024-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
9KAL The cryo-EM structure of Ac-E57A_G51DA53T a-syn fibril. Deposited 2024-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa）	Mutation：E57A,G51D,A53T Mutation：E57A,G51D,A53T Mutation：E57A,G51D,A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.36 Å
9KC2 Cryo-EM structure of ZSQ07-bound alpha-synuclein fibril polymorph 6A6B Deposited 2024-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa）	Not recorded	A1EFK 2-[(4~{E})-4-[(~{E})-3-(3-methyl-1,3-benzothiazol-2-yl)prop-2-enylidene]quinolin-1-yl]ethanol × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9KCN Cryo-EM structure of FD4-bound alpha-synuclein fibril polymorph 6A6B Deposited 2024-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain L 37–140（104 aa） Chain M 37–140（104 aa） Chain N 37–140（104 aa） Chain P 37–140（104 aa） Chain Q 37–140（104 aa） Chain R 37–140（104 aa） Chain d 37–140（104 aa） Chain e 37–140（104 aa） Chain f 37–140（104 aa） Chain h 37–140（104 aa） Chain i 37–140（104 aa） Chain j 37–140（104 aa）	Not recorded	A1EFL (2~{R})-1-fluoranyl-3-[[2-[(~{E})-2-[5-[6-(methylamino)pyridin-3-yl]pyridin-2-yl]ethenyl]-1,3-benzothiazol-6-yl]oxy]propan-2-ol × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9KCO Cryo-EM structure of FD4-bound alpha-synuclein MSA-like fibril Deposited 2024-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa） Chain Q 1–140（140 aa）	Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T Mutation：G51D,A53T	A1EFL (2~{R})-1-fluoranyl-3-[[2-[(~{E})-2-[5-[6-(methylamino)pyridin-3-yl]pyridin-2-yl]ethenyl]-1,3-benzothiazol-6-yl]oxy]propan-2-ol × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9KCP Cryo-EM structure of ACI-12589-bound alpha-synuclein fibril polymorph 6A6B Deposited 2024-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9M5K The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate Deposited 2025-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9M5L The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate Deposited 2025-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.27 Å
9O4B Cryo-EM structure of in-vitro alpha-synuclein fibril bound with Exemplar-6 PET-radioligand Deposited 2025-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	A1B9H 2-(3,4-dimethylphenoxy)-N-[3-(4-fluorophenyl)-1,2-oxazol-5-yl]acetamide × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9O9J Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease with G51D mutaion in SNCA Deposited 2025-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: 20-meric	Chain A 1–140（140 aa） Chain D 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.30 Å
9O9K Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease with H50Q variant in SNCA Deposited 2025-04-18	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain A 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9OBP Cryo-EM structure of alpha-synuclein filaments derived from the frontal cortex of the case of atypical multiple system atrophy Deposited 2025-04-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9QYL Alpha-synuclein fibril type 1A polymorph in the presence of ATP Deposited 2025-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa） Chain Q 1–140（140 aa） Chain e 1–140（140 aa） Chain f 1–140（140 aa） Chain g 1–140（140 aa） Chain h 1–140（140 aa） Chain j 1–140（140 aa） Chain k 1–140（140 aa） Chain l 1–140（140 aa） Chain m 1–140（140 aa） Chain n 1–140（140 aa） Chain o 1–140（140 aa） Chain p 1–140（140 aa） Chain q 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM Tris, 150 mM NaCl, pH 7.5, 1 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.08 Å
9QYN Alpha-synuclein K21A fibril type 1A polymorph in the presence of ATP Deposited 2025-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM Tris, 150 mM NaCl, pH 7.5, 1 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.13 Å
9RB3 A53T alpha-synuclein fibril - Type 1 Deposited 2025-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9RB6 A53T alpha-synuclein fibril - Type 2 Deposited 2025-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.02 Å
9RB7 Wild-type alpha-synuclein fibril - Type 1 Deposited 2025-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
9RB8 Wild-type alpha-synuclein fibril - Type 3-1 Deposited 2025-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.64 Å
9RB9 Wild-type alpha-synuclein fibril - Type 3-2 Deposited 2025-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
9RBA Wild-type alpha-synuclein fibril - Type 4 Deposited 2025-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å
9RBB Wild-type alpha-synuclein fibril - Type 5 Deposited 2025-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
9RZF Structure of in-vivo formed alpha-synuclein fibrils purified from a M83+/- mouse brain injected with recombinant 1B fibrils Deposited 2025-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 37–97（61 aa） Chain B 37–97（61 aa） Chain C 37–97（61 aa） Chain D 37–97（61 aa） Chain E 37–97（61 aa） Chain F 37–97（61 aa）	Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T Mutation：A53T	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；50 mM Tris-HCl, 150 mM NaCl, pH7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9TPT Structure of recombinantly assembled E83Q alpha-synuclein fibrils Deposited 2025-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain A 36–100（65 aa） Chain B 36–100（65 aa） Chain C 36–100（65 aa） Chain D 36–100（65 aa） Chain E 36–100（65 aa） Chain F 36–100（65 aa） Chain H 36–100（65 aa） Chain I 36–100（65 aa） Chain J 36–100（65 aa） Chain L 36–100（65 aa） Chain M 36–100（65 aa） Chain N 36–100（65 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.43 Å
9UF6 Cryo-EM structure of BA1-1-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa）	Not recorded	A1EO7 (2~{E})-1-ethyl-2-[(~{E})-3-(1-ethylquinolin-1-ium-2-yl)prop-2-enylidene]quinoline × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9UFD Cryo-EM structure of BA12-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa） Chain M 1–140（140 aa） Chain N 1–140（140 aa） Chain O 1–140（140 aa） Chain P 1–140（140 aa）	Not recorded	A1EO8 (2~{Z})-3-ethyl-2-[(~{E})-3-(3-ethyl-1,3-benzothiazol-3-ium-2-yl)prop-2-enylidene]-1,3-benzothiazole × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9UFF Cryo-EM structure of BA21-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	A1EO6 ~{N}-(1-ethyl-2-oxidanylidene-benzo[cd]indol-6-yl)-2,5-dimethoxy-benzamide × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9UFL Cryo-EM structure of BA22-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9UFS Cryo-EM structure of BA23-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9UFX Cryo-EM structure of HA11-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	A1EPA 2',4',5',7'-tetrakis(iodanyl)-3',6'-bis(oxidanyl)spiro[2-benzofuran-3,9'-xanthene]-1-one × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9UFY Cryo-EM structure of HA21-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	GO3 Gossypol × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9UG0 Cryo-EM structure of HA31-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	A1EPK 4-[(3~{R},5~{S})-3,5-dimethylpiperidin-1-yl]sulfonyl-~{N}'-(4-methyl-1,3-benzothiazol-2-yl)benzohydrazide × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9UG1 Cryo-EM structure of HA32-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa） Chain K 1–140（140 aa） Chain L 1–140（140 aa）	Not recorded	A1EPB 4-(3,4-dihydro-1~{H}-isoquinolin-2-ylsulfonyl)-~{N}'-(4-methyl-1,3-benzothiazol-2-yl)benzohydrazide × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9UJQ Cryo-EM structure of HQY1027-bound alpha-synuclein fibril polymorph 6A6B Deposited 2025-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9V6U The cryo-EM structure of FD4 bound Lewy fold fibril. Deposited 2025-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain c 1–140（140 aa） Chain d 1–140（140 aa） Chain e 1–140（140 aa） Chain f 1–140（140 aa） Chain g 1–140（140 aa） Chain h 1–140（140 aa） Chain i 1–140（140 aa） Chain j 1–140（140 aa） Chain k 1–140（140 aa） Chain o 1–140（140 aa） Chain p 1–140（140 aa） Chain q 1–140（140 aa） Chain r 1–140（140 aa） Chain s 1–140（140 aa） Chain t 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.30 Å
9V7C The cryo-EM structure of FD4_orientation2 bound Lewy fold fibril. Deposited 2025-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain c 32–101（70 aa） Chain d 32–101（70 aa） Chain e 32–101（70 aa） Chain f 32–101（70 aa） Chain g 32–101（70 aa） Chain h 32–101（70 aa） Chain i 32–101（70 aa） Chain j 32–101（70 aa） Chain k 32–101（70 aa） Chain o 32–101（70 aa） Chain p 32–101（70 aa） Chain q 32–101（70 aa） Chain r 32–101（70 aa） Chain s 32–101（70 aa） Chain t 32–101（70 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.30 Å
9Y0S CryoEM structure of alpha-synuclein fibril induced by psychosine Deposited 2025-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–140（140 aa） Chain B 1–140（140 aa） Chain C 1–140（140 aa） Chain D 1–140（140 aa） Chain E 1–140（140 aa） Chain F 1–140（140 aa） Chain G 1–140（140 aa） Chain H 1–140（140 aa） Chain I 1–140（140 aa） Chain J 1–140（140 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris-HCl, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.72 Å

226 other PDB entries and 234 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SYUA_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–5； UniProt 1–5

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8g0l
Deposition date deposition_date	2023-01-31
Structure title title	Semi-synthetic CoA-alpha-Synuclein Constructs Trap N-terminal Acetyltransferase NatB for Binding Mechanism Studies
Keywords keywords	N-terminal acetyltransferase, TRANSFERASE; TRANSFERASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	35.26 Å
Radius of gyration Rg (electron density) rg_electron	34.55 Å
Forward intensity I(0) i0	237056000.00
Molecular weight molecular_weight	126090.0 kDa
Excluded volume excluded_volume	158970 Å³
Envelope volume envelope_volume	216370 Å³
Hydration-shell volume shell_volume	51585 Å³
Envelope diameter envelope_diameter	121.4 Å
Shell Rg shell_rg	41.79 Å
Envelope Rg envelope_rg	34.03 Å
Shape Rg shape_rg	34.52 Å
Total Rg total_rg	35.22 Å
Total atoms total_atoms	8872
Residues n_residues	1088
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	111.0 Å
Rg (real space) rg_real	35.11 Å
Rg uncertainty (real space) rg_real_error	0.70 Å
I(0) (real space) i0_real	2.3710e+08
I(0) uncertainty (real space) i0_real_error	3.8680e+06
Rg (reciprocal space) rg_reciprocal	35.20 Å
I(0) (reciprocal space) i0_reciprocal	237100000.0000
Solution quality estimate total_estimate	0.9029
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	44.4 Å
Skewness Skewness skewness	0.170
Kurtosis Kurtosis kurtosis	-0.507
Angular range angular_range	— – 0.2250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	43660000.0000
Real-space data points n_real_points	46
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.933; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.992; Smooth: 0.943

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	N-alpha-acetyltransferase 20
Molecular weight formula_weight	20390.1 kDa
EC 编号 ec_number	2.3.1.254
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	8872

MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	N-alpha-acetyltransferase 25, NatB auxiliary subunit
Molecular weight formula_weight	112444.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAKVLKAIGLQRTGKQEEAFTLAQEVAALEPTDDNSLQALTILYREMHRPELVTKLYEAAVKKVPNSEEYHSHLFMAYARVGEYKKMQQAGMALYKIVPKNPYYFWSVMSLIMQSISAQDENLSKTMFLPLAERMVEKMVKEDKIEAEAEVELYYMILERLGKYQEALDVIRGKLGEKLTSEIQSRENKCMAMYKKLSRWPECNALSRRLLLKNSDDWQFYLTYFDSVFRLIEEAWSPPAEGEHSLEGEVHYSAEKAVKFIEDRITEESKSSRHLRGPHLAKLELIRRLRSQGCNDEYKLGDPEELMFQYFKKFGDKPCCFTDLKVFVDLLPATQCTKFINQLLGVVPLSTPTEDKLALPADIRALQQHLCVVQLTRLLGLYHTMDKNQKLSVVRELMLRYQHGLEFGKTCLKTELQFSDYYCLLAVHALIDVWRETGDETTVWQALTLLEEGLTHSPSNAQFKLLLVRIYCMLGAFEPVVDLYSSLDAKHIQHDTIGYLLTRYAESLGQYAAASQSCNFALRFFHSNQKDTSEYIIQAYKYGAFEKIPEFIAFRNRLNNSLHFAQVRTERMLLDLLLEANISTSLAESIKSMNLRPEEDDIPWEDLRDNRDLNVFFSWDPKDRDVSEEHKKLSLEEETLWLRIRSLTLRLISGLPSLNHPVEPKNSEKTAENGVSSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLENLVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTLISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELLKKRLETTKKLKI

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Alpha-synuclein
Molecular weight formula_weight	641.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDVFM

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21

Entity 4 Entity 4 non-polymer

Description description	CARBOXYMETHYL COENZYME *A
Molecular weight formula_weight	825.6 kDa
Source method src_method	syn
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	8g0lB01
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	1040 —

▶

8. Citations (2)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.39 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	192518

fit	/app/data/saxs_computation/g0/8g0l/8g0l.fit
pddf	/app/data/pr_computation/g0/8g0l/8g0l.pr.out
profile	/app/data/saxs_computation/g0/8g0l/8g0l.dat

Semi-synthetic CoA-alpha-Synuclein Constructs Trap N-terminal Acetyltransferase NatB for Binding Mechanism Studies

1. Protein Identity and Related Structures Protein Identity & Related Structures

N-alpha-acetyltransferase 20

State in the Current Structure

Other States of the Same Protein in the Database

N-alpha-acetyltransferase 25, NatB auxiliary subunit

State in the Current Structure

Other States of the Same Protein in the Database

Alpha-synuclein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)