5oqm

STRUCTURE OF YEAST TRANSCRIPTION PRE-INITIATION COMPLEX WITH TFIIH AND CORE MEDIATOR

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1733； UniProt 1–1733

DNA-directed RNA polymerase II subunit RPB2

OrganismNot specified

UniProt P08518

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1224； UniProt 1–1224

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt P16370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–318； UniProt 1–318

DNA-directed RNA polymerase II subunit RPB4

OrganismNot specified

UniProt P20433

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–221； UniProt 1–221

DNA-directed RNA polymerases I, II, and III subunit RPABC1

OrganismNot specified

UniProt P20434

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215

DNA-directed RNA polymerases I, II, and III subunit RPABC2

OrganismNot specified

UniProt P20435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt P34087

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–171； UniProt 1–171

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt P20436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB3_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 1–146

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P27999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–122； UniProt 1–122

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt P22139

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerase II subunit RPB11

OrganismNot specified

UniProt P38902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB11_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–120； UniProt 1–120

DNA-directed RNA polymerases I, II, and III subunit RPABC4

OrganismNot specified

UniProt P40422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB4_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–70； UniProt 1–70

Transcription initiation factor IIB

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P29055

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2B_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–345； UniProt 1–345

TATA-box-binding protein

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P13393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–240； UniProt 1–240

Transcription initiation factor IIF subunit alpha

Saccharomyces cerevisiae

UniProt A0A250WD40

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A250WD40_YEASX
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Q； PDBConstruct 416–747； UniProt 404–735

Transcription initiation factor IIF subunit alpha

Saccharomyces cerevisiae

UniProt P41895

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FA_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Q； PDBConstruct 1–403； UniProt 1–403

Transcription initiation factor IIF subunit beta

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P41896

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FB_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain R； PDBConstruct 1–400； UniProt 1–400

Transcription initiation factor IIA large subunit

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32773

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOA1_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain U； PDBConstruct 1–286； UniProt 1–286

Transcription initiation factor IIA subunit 2

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32774

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2AG_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain V； PDBConstruct 1–122； UniProt 1–122

Transcription factor TFIIE subunit

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt A0A250WIP3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A250WIP3_YEASX
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 1–194； UniProt 1–194

Transcription factor TFIIE subunit

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P36100

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2EA_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 254–541； UniProt 195–482

Transcription initiation factor IIE subunit beta

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P36145

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2EB_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain X； PDBConstruct 1–328； UniProt 1–328

General transcription and DNA repair factor IIH helicase subunit XPD

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P06839

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAD3_YEAST
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 0； PDBConstruct 1–293； UniProt 1–293 Author chain 0； PDBConstruct 328–778； UniProt 328–778

General transcription and DNA repair factor IIH subunit TFB1

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32776

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB1_YEAST
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 1； PDBConstruct 1–121； UniProt 1–121 Author chain 1； PDBConstruct 130–172； UniProt 176–218 Author chain 1； PDBConstruct 204–249； UniProt 250–295 Author chain 1； PDBConstruct 390–510； UniProt 522–642

General transcription and DNA repair factor IIH subunit TFB2

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q02939

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB2_YEAST
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain 2； PDBConstruct 1–112； UniProt 1–112 Author chain 2； PDBConstruct 160–194； UniProt 160–194 Author chain 2； PDBConstruct 215–281； UniProt 215–281 Author chain 2； PDBConstruct 322–553； UniProt 282–513

RNA polymerase II transcription factor B subunit 3

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q03290

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB3_YEAST
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 3； PDBConstruct 1–321； UniProt 1–321

General transcription and DNA repair factor IIH subunit TFB4

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q12004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB4_YEAST
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 4； PDBConstruct 1–88； UniProt 1–88 Author chain 4； PDBConstruct 115–251； UniProt 120–256 Author chain 4； PDBConstruct 269–333； UniProt 274–338

General transcription and DNA repair factor IIH subunit TFB5

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q3E7C1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB5_YEAST
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 5； PDBConstruct 1–72； UniProt 1–72

General transcription and DNA repair factor IIH subunit SSL1

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q04673

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSL1_YEAST
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 6； PDBConstruct 1–307； UniProt 1–307 Author chain 6； PDBConstruct 325–372； UniProt 325–372 Author chain 6； PDBConstruct 387–411； UniProt 387–411 Author chain 6； PDBConstruct 425–461； UniProt 425–461

General transcription and DNA repair factor IIH helicase subunit XPB

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q00578

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAD25_YEAST
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 7； PDBConstruct 1–425； UniProt 1–425 Author chain 7； PDBConstruct 482–843； UniProt 482–843

Mediator of RNA polymerase II transcription subunit 6

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P38782

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED6_YEAST
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain a； PDBConstruct 1–295； UniProt 1–295

Mediator of RNA polymerase II transcription subunit 8

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P38304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED8_YEAST
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain b； PDBConstruct 1–223； UniProt 1–223

Mediator of RNA polymerase II transcription subunit 11

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q99278

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED11_YEAST
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain c； PDBConstruct 1–115； UniProt 1–115

Mediator of RNA polymerase II transcription subunit 17

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32569

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED17_YEAST
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain d； PDBConstruct 1–687； UniProt 1–687

Mediator of RNA polymerase II transcription subunit 18

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32585

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED18_YEAST
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain e； PDBConstruct 1–307； UniProt 1–307

Mediator of RNA polymerase II transcription subunit 20

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P34162

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED20_YEAST
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain f； PDBConstruct 1–210； UniProt 1–210

Mediator of RNA polymerase II transcription subunit 22

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32570

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED22_YEAST
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain g； PDBConstruct 1–121； UniProt 1–121

Mediator of RNA polymerase II transcription subunit 4

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q12343

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED4_YEAST
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain h； PDBConstruct 1–125； UniProt 1–125 Author chain h； PDBConstruct 142–300； UniProt 126–284

Mediator of RNA polymerase II transcription subunit 7

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q08278

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED7_YEAST
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain i； PDBConstruct 1–223； UniProt 1–222

Mediator of RNA polymerase II transcription subunit 9

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P33308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED9_YEAST
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain j； PDBConstruct 1–149； UniProt 1–149

Mediator of RNA polymerase II transcription subunit 10

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q06213

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED10_YEAST
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain k； PDBConstruct 1–157； UniProt 1–157

Mediator of RNA polymerase II transcription subunit 14

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P19263

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED14_YEAST
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain l； PDBConstruct 1–745； UniProt 1–745

Mediator of RNA polymerase II transcription subunit 19

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P25046

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED19_YEAST
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain m； PDBConstruct 1–220； UniProt 1–220

Mediator of RNA polymerase II transcription subunit 21

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P47822

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED21_YEAST
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain n； PDBConstruct 1–140； UniProt 1–140

Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P38633

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 44 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） NONTEMPLATE DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIF subunit alpha × 1 （A0A250WD40,P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） TEMPLATE DNA × 1 Transcription initiation factor IIA large subunit × 1 （P32773） Transcription initiation factor IIA subunit 2 × 1 （P32774） Transcription factor TFIIE subunit × 1 （A0A250WIP3,P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） Unknown protein × 1 Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） ZINC ION × 16 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED31_YEAST
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain o； PDBConstruct 1–127； UniProt 1–127

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5oqm
Deposition date deposition_date	2017-08-13
Structure title title	STRUCTURE OF YEAST TRANSCRIPTION PRE-INITIATION COMPLEX WITH TFIIH AND CORE MEDIATOR
Keywords keywords	transcription initiation, TRANSCRIPTION, macromolecular complex; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5oqm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5oqm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5oqm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	89.96 Å
Rg (electron density)	88.94 Å
Total Rg	88.26 Å
Atom count	79755
Residues	10973
Excluded volume	1392200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5oqm__assembly_1__model_1`	46-meric （46）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (49)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase II subunit RPB1
Molecular weight formula_weight	191821.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	79757

MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase II subunit RPB2
Molecular weight formula_weight	138937.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTDRSRDF

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	35330.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	25451.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	25117.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	17931.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19081.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16525.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14308.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	8290.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11
Molecular weight formula_weight	13633.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC4
Molecular weight formula_weight	7730.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR

Entity 13 Entity 13 polymer

Description description	Transcription initiation factor IIB
Molecular weight formula_weight	38257.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 14 Entity 14 polymer

Description description	NONTEMPLATE DNA
Molecular weight formula_weight	32717.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

CGAGAACAGTAGCACGCTGTGTATATAATAGCTATGGAACGTTCGATTCACCTCCGATGTGTGTTGTACATACATAAAAATATCATAGCACAACTGCGCTGTGTCA

Entity 15 Entity 15 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	27042.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 16 Entity 16 polymer

Description description	Transcription initiation factor IIF subunit alpha
Molecular weight formula_weight	83341.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSRRNPPGSRNGGGPTNASPFIKRDRMRRNFLRMRMGQNGSNSSSPGVPNGDNSRGSLVKKDDPEYAEEREKMLLQIGVEADAGRSNVKVKDEDPNEYNEFPLRAIPKEDLENMRTHLLKFQSKKKINPVTDFHLPVRLHRKDTRNLQFQLTRAEIVQRQKEISEYKKKAEQERSTPNSGGMNKSGTVSLNNTVKDGSQTPTVDSVTKDNTANGVNSSIPTVTGSSVPPASPTTVSAVESNGLSNGSTSAANGLDGNASTANLANGRPLVTKLEDAGPAEDPTKVGMVKYDGKEVTNEPEFEEGTMDPLADVAPDGGGRAKRGNLRRKTRQLKVLDENAKKLRFEEFYPWVMEDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTARNKYATXXXXXXXXXXXXLTIDEAEKRMDKKSGEVPRWLMKHLDNIGTTTTRYDRTRRKLKAVADQQAMDEDDRDDNSEVELDYDEEFADDEEAPIIDGNEQENKESEQRIKKEMLQANAMGLRDEEAPSENEEDELFGEKKIDEDGERIKKALQKTELAALYSSDENEINPYLSESDIENKENESPVKKEEDSDTLSKSKRSSPKKQQKKATNAHVHKEPTLRVKSIKNCVIILKGDKKILKSFPEGEWNPQTTKAVDSSNNASNTVPSPIKQEEGLNSTVAEREETPAPTITEKDIIEAIGDGKVNIKEFGKFIRRKYPGAENKKLMFAIVKKLCRKVGNDHMELKKE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 17 Entity 17 polymer

Description description	Transcription initiation factor IIF subunit beta
Molecular weight formula_weight	46684.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MSSGSAGAPALSNNSTNSVAKEKSGNISGDEYLSQEEEVFDGNDIENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINKDGSKITLLLNENDNDSIPHEYDLELTKKVVENEYVFTEQNLKKYQQRKKELEADPEKQRQAYLKKQEREEELKKKQQQQKRRNNRKKFNHRVMTDRDGRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQRRNIVKLNNKERITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYAFKYTLRPEYKKLKEEERKATLGELADEQTGSAGDNAQGDAEADLEDEIEMEDVV

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 18 Entity 18 polymer

Description description	TEMPLATE DNA
Molecular weight formula_weight	32680.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

TGACACAGCGCAGTTGTGCTATGATATTTTTATGTATGTACAACACACATCGGAGGTGAATCGAACGTTCCATAGCTATTATATACACAGCGTGCTACTGTTCTCG

Entity 19 Entity 19 polymer

Description description	Transcription initiation factor IIA large subunit
Molecular weight formula_weight	32230.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFNEGNINGVQNDLNFNLATPGVNSSEFNIKEENTGNEGLILPNINSNNNIPHSGETNINTNTVEATNNSGATLNTNTSGNTNADVTSQPKIEVKPEIELTINNANITTVENIDDESEKKDDEEKEEDVEKTRKEKEQIEQVKLQAKKEKRSALLDTDEVGSELDDSDDDYLISEGEEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 20 Entity 20 polymer

Description description	Transcription initiation factor IIA subunit 2
Molecular weight formula_weight	13473.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKKSE

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 21 Entity 21 polymer

Description description	Transcription factor TFIIE subunit
Molecular weight formula_weight	59825.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MDRPIDDIVKNLLKFVVRGFYGGSFVLVLDAILFHSVLAEDDLKQLLSINKTELGPLIARLRSDRLISIHKQREYPPNSKSVERVYYYVKYPHAIDAIKWKVHQVVQRLKDDLDKNSEPNGYMCPICLTKYTQLEAVQLLNFDRTEFLCSLCDEPLVEDDSGKKNKEKQDKLNRLMDQIQPIIDSLKKIDDSRIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEENTFEIALARLIPPQNQSHAAYTYNPKKGSTMFRPGDSAPLPNLMGTALGNDSSRRAGANSQATLHINITTASDEVAQRELQERQAEEKRKQNAVPEWHKQSTIGKTALGRLDNEEEFDPVVTASAMDSINPDNEPAQETSYQNNRTLTEQEMEERENEKTLNDYYAALAKKQAKLNKEEEEEEEEEEDEEEEEEEEMEDVMDDNDETARENALEDEFEDVTDTAGTAKTESNTSNDVKQESINDKTEDAVNATATASGPSANAKPNDGDDDDDDDDDEMDIEFEDV

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 22 Entity 22 polymer

Description description	Transcription initiation factor IIE subunit beta
Molecular weight formula_weight	37050.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSKNRDPLLANLNAFKSKVKSAPVIAPAKVGQKKTNDTVITIDGNTRKRTASERAQENTLNSAKNPVLVDIKKEAGSNSSNAISLDDDDDDEDFGSSPSKKVRPGSIAAAALQANQTDISKSHDSSKLLWATEYIQKKGKPVLVNELLDYLSMKKDDKVIELLKKLDRIEFDPKKGTFKYLSTYDVHSPSELLKLLRSQVTFKGISCKDLKDGWPQCDETINQLEEDSKILVLRTKKDKTPRYVWYNSGGNLKCIDEEFVKMWENVQLPQFAELPRKLQDLGLKPASVDPATIKRQTKRVEVKKKRQRKGKITNTHMTGILKDYSHRV

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 23 Entity 23 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPD
Molecular weight formula_weight	89064.6 kDa
EC 编号 ec_number	3.6.4.12,3.6.4.12,3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MKFYIDDLPVLFPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTVSLLSLTIAYQMHYPEHRKIIYCSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNGQAKRKLEEDPEANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTLCPYFIVRRMISLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSLDLTTDALRRATRGANALDERISEVRKVDSQKLQDEYEKLVQGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAEHFVSFLKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIERKPLRFCSERLSLLVRTLEVTEVEDFTALKDIATFATLISTYEEGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVFERFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSFLPMIITKGSDQVAISSRFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIVSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRENYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADRRFSRKRSQLPKWIAQGLSDADLNLSTDMAISNTKQFLRTMAQPTDPKDQEGVSVWSYEDLIKHQNSRKDQGGFIENENKEGEQDEDEDEDIEMQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 24 Entity 24 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB1
Molecular weight formula_weight	53385.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADIYEEKRXXXXXXXXTNLKLQQSLLKGNKVLMKVFQETVINAGLPPSEFWSTRIPLLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSALGSFVDNTSQANELEVKSTLPIDLLESCRMLHTTCCEFLKHFYIHFQSGEQKQASTVKKLYNHLKDCIEKLNELFQDVLNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 25 Entity 25 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB2
Molecular weight formula_weight	60168.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MSDYSLKHSVTQYLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAMVFNENEVPLLDLDKWVNSNGKLQFQNAIKSMKSLHLLIPNKSSGTLMINLNPTFKISLRNALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEKVLNLLKHSKLMEEVNSTGEFKITNEGFQFLLQXXXXXXXXXXXXXXXXXXXXKMDLVDVLHFIFMLGALEVGKAYKIDALSETQRIMLQDMRDYGLVFQKHSNDSIFYPTKLALMLTSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKTIRSASNAMDSVLRQNREEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSYSNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYLETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRKLKKKQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 26 Entity 26 polymer

Description description	RNA polymerase II transcription factor B subunit 3
Molecular weight formula_weight	38188.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MLMDEYEENKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKGCDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNKYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIMNNLERSRTEIESFEQRQKFEKEMKLKKRLLERQIEEEERMNKEWTKKEIVNRLSTTTQDINETIEGVKNTVKLKKSSARRKLEELNRVLKNNPYFNSNVNVQNSRLKDAVPFTPFNGDREAHPRFTLKGSVYNDPFIKDLEHRKEFIASGFNTNYAYERVLTEAFMGLGCVISEEL

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 27 Entity 27 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB4
Molecular weight formula_weight	35978.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVFLNAHLAFNSANKVAVIAAYSQGIKYLYPXXXXXXXXXXXXXXXXXXXXXYRRFRNVDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVESTEGLIQYLATAMFIDPXXXXXXXXXXXXXXXXXTSCYLTGRVVAVGFICSVCLCVLSIIPPGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKKKVTKP

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 28 Entity 28 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB5
Molecular weight formula_weight	8243.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYNPMDEEENQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 29 Entity 29 polymer

Description description	General transcription and DNA repair factor IIH subunit SSL1
Molecular weight formula_weight	51122.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAPVVISESEEDEDRVAITRRTKRQVHFDGEGDDRVDQQQQQHSSSHRDRDKHVQRKKKKRLSNRNLQGSNGGYAWEDEIKRSWDLVKVDDEGDMASLVASIVEARKKRTAKKNITPYQRGIIRSLILTLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNYGDESFYKILLDETHLKELFNEAVTPXXXXXXXXXXXXXXXXXPTRIFEDTPTFCSCHSKLVYGGYFCPNCHSKVCSLPTVCPCCDLMLILXXXXXXXXXXXXXXKTFAEVPTTEKFRSEDCFSCQSRFPXXXXXXXXXXXXXSRYRCEDCKQEFCVDCDVFIHEILHNCPGCESKPVIT

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 30 Entity 30 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPB
Molecular weight formula_weight	94049.7 kDa
EC 编号 ec_number	3.6.4.12,3.6.4.12,3.6.4.12,3.6.4.12,3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MTDVEGYQPKSKGKIFPDMGESFFSSDEDSPATDAEIDENYDDNRETSEGRGERDTGAMVTGLKKPRKKTKSSRHTAADSSMNQMDAKDKALLQDTNSDIPADFVPDSVSGMFRSHDFSYLRLRPDHASRPLWISPSDGRIILESFSPLAEQAQDFLVTIAEPISRPSHIHEYKITAYSLYAAVSVGLETDDIISVLDRLSKVPVAESIINFIKGATISYGKVKLVIKHNRYFVETTQADILQMLLNDSVIGPLRIDSDHQVQPPEDVLQQQLQQTAGKPATNVNPNDVEAVFSAVIGGDNEREEEDDDIDAVHSFEIANESVEVVKKRCQEIDYPVLEEYDFRNDHRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQWRQQFLXXXXXXXXXXXXXXXXXXXXXXXXXXLVVSTYSMVANXXXXXXXXXXXXXXXXXXXWGFIILDEVHVVPAAMFRRVVSTIAAHAKLGLTATLVREDDKIGDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRGDKIIVFSDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLHGMENIPNLAYASPRERRELLQEVLLKNEEAAGIEVGDDADNSVGRGSNGHKRFKSKAVRGEGSLSGLAGGEDMAYMEYSTNKNKELKEHHPLIRKMYYKNLKK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 31 Entity 31 polymer

Description description	Unknown protein
Molecular weight formula_weight	3677.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 32 Entity 32 polymer

Description description	Mediator of RNA polymerase II transcription subunit 6
Molecular weight formula_weight	32844.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 33 Entity 33 polymer

Description description	Mediator of RNA polymerase II transcription subunit 8
Molecular weight formula_weight	25297.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 34 Entity 34 polymer

Description description	Mediator of RNA polymerase II transcription subunit 11
Molecular weight formula_weight	13324.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 35 Entity 35 polymer

Description description	Mediator of RNA polymerase II transcription subunit 17
Molecular weight formula_weight	78582.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MTTEDPDSNHLSSETGIKLALDPNLITLALSSNPNSSLHSPTSDEPVPESAGKADTSIRLEGDELENKTKKDNDKNLKFLKNKDSLVSNPHEIYGSMPLEQLIPIILRQRGPGFKFVDLNEKELQNEIKQLGSDSSDGHNSEKKDTDGADENVQIGEDFMEVDYEDKDNPVDSRNETDHKTNENGETDDNIETVMTQEQFVKRRRDMLEHINLAMNESSLALEFVSLLLSSVKESTGMSSMSPFLRKVVKPSSLNSDKIPYVAPTKKEYIELDILNKGWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNKDVIFKIRDRTSGQKLLAIKYGYEDSGSTYKHDRGIANIRNNIESQNLDLIPHSSSVFKGTDFVHSVKKFLRVRIFTKIESEDDYILSGESVMDRDSESEEAETKDIRKQIQLLKKIIFEKELMYQIKKECALLISYGVSIENENKVIIELPNEKFEIELLSLDDDSIVNHEQDLPKINDKRANLMLVMLRLLLVVIFKKTLRSRISSPHGLINLNVDDDILIIRPILGKVRFANYKLLLKKIIKDYVLDIVPGSSITETEVEREQPQENKNIDDENITKLNKEIRAFDKLLNIPRRELKINLPLTEHKSPNLSLMLESPNYCNALIHIKFSAGTEANAVSFDTTFSDFKEVEDFLHFIVAEYIQQKKV

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 36 Entity 36 polymer

Description description	Mediator of RNA polymerase II transcription subunit 18
Molecular weight formula_weight	34316.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 37 Entity 37 polymer

Description description	Mediator of RNA polymerase II transcription subunit 20
Molecular weight formula_weight	22918.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 38 Entity 38 polymer

Description description	Mediator of RNA polymerase II transcription subunit 22
Molecular weight formula_weight	13875.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 39 Entity 39 polymer

Description description	Mediator of RNA polymerase II transcription subunit 4
Molecular weight formula_weight	33606.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELXXXXXXXXXXXXXXXXKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPPSQSEEQKGQMAKKEGTPKTDSFIFDGTAKEVGDEADNTKDKEKEENNDDALDLDLDLFDPDDF

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 40 Entity 40 polymer

Description description	Mediator of RNA polymerase II transcription subunit 7
Molecular weight formula_weight	25687.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MSNDPGNEVSSLYSPTSPSYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITCALDYLIPPPMPKNQQYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELRKLLKSLLLNYLELIGVLSINPDMYERKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIEQVCKQVHDKLTSIQDTLRTGSQSPPSSSQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 41 Entity 41 polymer

Description description	Mediator of RNA polymerase II transcription subunit 9
Molecular weight formula_weight	17400.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTSSNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPSEWQDIIHQREQELQIKRDVLDDLYRKLQR

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 42 Entity 42 polymer

Description description	Mediator of RNA polymerase II transcription subunit 10
Molecular weight formula_weight	17927.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MNGNSTNNEQLQQELATTQDQVASIIESFVELGVSIYDFPGTPEATKGMITNLQRNVDRLYKLNVRSNDPQSSLSKVDIPLEVVQYIEDGRNPDIYTREFVEAIRRSNQYQRGKMHGLKQLRDSLADKIVDEFPELKEPVEDIIKRTSPIDNVSNTH

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 43 Entity 43 polymer

Description description	Mediator of RNA polymerase II transcription subunit 14
Molecular weight formula_weight	84746.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MTTTIGSPQMLANEERLSNEMHALKNRSEQNGQEQQGPVKNTQLHGPSATDPETTATQKESLEMVPKDTSAATMTSAPPPALPHVEINQVSLALVIRNLTVFTMKELAQYMKTNVHTQANEPNSAKKIRFLQLIIFLRTQFLKLYVLVKWTRTIKQNNFHVLIDLLNWFRTTNMNVNNCIWALKSSLNSMTNAKLPNVDLVTALEVLSLGRPNLPTHNFKLSGVSNSMDMVDGMAKVPIGLILQRLKDLNLTVSIKIALMNIPKPLNSYHIKNGRIYFTVPNEFEIQLSTVNRQSPLFFVDLKLLFNTEAEQTVSAVTEATSTNGDSENNEENSSSNGNNLPLNKPRLEKLINEILLKSNDPLLSLYNFLHKYVLTLQLYMVHREFLKLANGGKFSKSNLIHNYDSKKSTITVRYWLNGKMDSKGKITIGIQRTTESLILKWDNQSASRAKNMPVIYNNIVSNIEGILDEIMFNHARIIRSELLARDIFQEDEENSDVLLFQLPTTCVSMAPIQLKIDLLSGQFYFRNPTPLLSNYASKINRAEGPEELARILQQLKLDKIIHVLTTMFENTGWSCSRIIKIDKPIRTQVNTGGESVVKKEDNKYAIAGNSTTNSDVSLLLQRDLFIRLPHWPLNWYLILSIISSKTSCVVEKRIGKIVSQRGKWNLKYLDNSNVMTVKLESITYQKIMILQRTILNRIINHMLIDSLNQLEIRNKICSSEMINEQKLPQYIIQGSNTNDNISII

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 44 Entity 44 polymer

Description description	Mediator of RNA polymerase II transcription subunit 19
Molecular weight formula_weight	24885.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MASRVDETTVPSYYYYVDPETTYTYQQPNPLQDLISVYGLDDISRQVARTNLDGTKAVKLRKSYKNQIADLSGKFSTIPTRENGKGGQIAHILFQNNPDMMIQPPQQGQNMSEQQWREQLRNRDIALFQPPNFDWDLCSSVLSQFERSYPSEFANQNQGGAQAPFDIDDLAFDLDGTGKSQSGSNSGNNSKKRKNKSSGSSMATPTHSDSHEDMKRRRLE

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 45 Entity 45 polymer

Description description	Mediator of RNA polymerase II transcription subunit 21
Molecular weight formula_weight	16093.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MTDRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVNEPQMSDKHATVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLRHVDSLIEDFVDGIANSKKST

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 46 Entity 46 polymer

Description description	Mediator of RNA polymerase II transcription subunit 31,Mediator of RNA polymerase II transcription subunit 31
Molecular weight formula_weight	16790.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MSSTNGNAPATPSSDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELPKIIQLQGPQWMNEMVERWANXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 47 Entity 47 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 48 Entity 48 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 49 Entity 49 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	5.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	16000

STRUCTURE OF YEAST TRANSCRIPTION PRE-INITIATION COMPLEX WITH TFIIH AND CORE MEDIATOR

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer