7nvg

Salmonella flagellar basal body refined in C1 map

Method: ELECTRON MICROSCOPY D_max: 303.4 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain A1； UniProt 1–560 Chain B1； UniProt 1–560 Chain C1； UniProt 1–560 Chain D1； UniProt 1–560 Chain E1； UniProt 1–560 Chain F1； UniProt 1–560 Chain G1； UniProt 1–560 Chain H1； UniProt 1–560 Chain I1； UniProt 1–560 Chain J1； UniProt 1–560 Chain K1； UniProt 1–560 Chain L1； UniProt 1–560 Chain M1； UniProt 1–560 Chain N1； UniProt 1–560 Chain O1； UniProt 1–560 Chain P1； UniProt 1–560 Chain Q1； UniProt 1–560 Chain R1； UniProt 1–560 Chain S1； UniProt 1–560 Chain T1； UniProt 1–560 Chain U1； UniProt 1–560 Chain V1； UniProt 1–560 Chain W1； UniProt 1–560 Chain X1； UniProt 1–560 Chain Y1； UniProt 1–560 Chain Z1； UniProt 1–560 Chain a1； UniProt 1–560 Chain b1； UniProt 1–560 Chain c1； UniProt 1–560 Chain d1； UniProt 1–560 Chain e1； UniProt 1–560 Chain f1； UniProt 1–560 Chain g1； UniProt 1–560 Chain h1； UniProt 1–560	Not recorded	Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7NVG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6SD1 Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 33-fold symmetry applied Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
6SD2 Structure of the RBM2inner region of the Salmonella flagella MS-ring protein FliF with 21-fold symmetry applied. Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 21 PDB declaration: 21-meric	Chain A 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain L 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain W 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6SD3 34mer structure of the Salmonella flagella MS-ring protein FliF Deposited 2019-07-26	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6SD4 Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 34-fold symmetry applied Deposited 2019-07-26	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
6SD5 Structure of the RBM2 inner ring of Salmonella flagella MS-ring protein FliF with 22-fold symmetry applied Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain A 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain R 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6TRE Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 32-fold symmetry applied Deposited 2019-12-18	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 32 PDB declaration: 32-meric	Chain 1 1–560（560 aa） Chain 2 1–560（560 aa） Chain 3 1–560（560 aa） Chain 4 1–560（560 aa） Chain 5 1–560（560 aa） Chain 6 1–560（560 aa） Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7BK0 Salmonella FliF ring (34mer) in intact basal body - C1 Deposited 2021-01-14	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7CG0 Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella Deposited 2020-06-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CG7 Cryo-EM structure of the flagellar MS ring with C34 symmetry from Salmonella Deposited 2020-06-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.61 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa） Chain Ca 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Cc 1–560（560 aa） Chain Cd 1–560（560 aa） Chain Ce 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cg 1–560（560 aa） Chain Ch 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cj 1–560（560 aa） Chain Ck 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cm 1–560（560 aa） Chain Cn 1–560（560 aa） Chain Co 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cq 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cs 1–560（560 aa） Chain Ct 1–560（560 aa） Chain Cu 1–560（560 aa） Chain Cv 1–560（560 aa） Chain Cw 1–560（560 aa） Chain Cx 1–560（560 aa） Chain Cy 1–560（560 aa） Chain Cz 1–560（560 aa） Chain Da 1–560（560 aa） Chain Db 1–560（560 aa） Chain Dc 1–560（560 aa） Chain Dd 1–560（560 aa） Chain De 1–560（560 aa） Chain Df 1–560（560 aa） Chain Dg 1–560（560 aa） Chain Dh 1–560（560 aa） Chain Di 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dk 1–560（560 aa） Chain Dl 1–560（560 aa） Chain Dm 1–560（560 aa） Chain Dn 1–560（560 aa） Chain Do 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dq 1–560（560 aa） Chain Dr 1–560（560 aa） Chain Ds 1–560（560 aa） Chain Dt 1–560（560 aa） Chain Du 1–560（560 aa） Chain Dv 1–560（560 aa） Chain Dw 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Eh 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7D84 34-fold symmetry Salmonella S ring formed by full-length FliF Deposited 2020-10-07	Different oligomeric state	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
7E81 Cryo-EM structure of the flagellar MS ring with FlgB-Dc loop and FliE-helix 1 from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 68 PDB declaration: 68-meric	Chain Ca 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Cc 1–560（560 aa） Chain Cd 1–560（560 aa） Chain Ce 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Ch 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cj 1–560（560 aa） Chain Ck 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cm 1–560（560 aa） Chain Cn 1–560（560 aa） Chain Co 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cq 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cs 1–560（560 aa） Chain Ct 1–560（560 aa） Chain Cu 1–560（560 aa） Chain Cv 1–560（560 aa） Chain Cw 1–560（560 aa） Chain Cx 1–560（560 aa） Chain Cy 1–560（560 aa） Chain Cz 1–560（560 aa） Chain Da 1–560（560 aa） Chain Db 1–560（560 aa） Chain Dc 1–560（560 aa） Chain Dd 1–560（560 aa） Chain De 1–560（560 aa） Chain Df 1–560（560 aa） Chain Dg 1–560（560 aa） Chain Dh 1–560（560 aa） Chain Di 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dk 1–560（560 aa） Chain Dl 1–560（560 aa） Chain Dm 1–560（560 aa） Chain Dn 1–560（560 aa） Chain Do 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dq 1–560（560 aa） Chain Dr 1–560（560 aa） Chain Ds 1–560（560 aa） Chain Dt 1–560（560 aa） Chain Du 1–560（560 aa） Chain Dv 1–560（560 aa） Chain Dw 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Fh 1–560（560 aa） Chain cg 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 4.50 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8FTE CryoEM strucutre of 22-mer RBM2 of the Salmonella MS-ring Deposited 2023-01-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.1 % Ana-grade LDAO cryo-EM vitrification conditions Cryogen ETHANE；Purified MS-rings were added to each grid at 277.15K at 100% humidity. After 30 sec of incubation, blotting was performed for 12 sec. The grid was then plunged into liquid ethane using a Vitrobot Mark IV system (Thermo Fisher)	Resolution 3.80 Å
8FTF CryoEM strucutre of 33-mer RBM3 of the Salmonella MS-ring Deposited 2023-01-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain AA 1–560（560 aa） Chain B 1–560（560 aa） Chain BA 1–560（560 aa） Chain C 1–560（560 aa） Chain CA 1–560（560 aa） Chain D 1–560（560 aa） Chain DA 1–560（560 aa） Chain E 1–560（560 aa） Chain EA 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain G 1–560（560 aa） Chain GA 1–560（560 aa） Chain H 1–560（560 aa） Chain HA 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.1 % Ana-grade LDAO cryo-EM vitrification conditions Cryogen ETHANE；Purified MS-rings were added to each grid at 277.15K at 100% humidity. After 30 sec of incubation, blotting was performed for 12 sec. The grid was then plunged into liquid ethane using a Vitrobot Mark IV system (Thermo Fisher)	Resolution 2.90 Å
8T8P 33-mer FliF MS-ring from Salmonella Deposited 2023-06-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain AA 1–560（560 aa） Chain B 1–560（560 aa） Chain BA 1–560（560 aa） Chain C 1–560（560 aa） Chain CA 1–560（560 aa） Chain D 1–560（560 aa） Chain DA 1–560（560 aa） Chain E 1–560（560 aa） Chain EA 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain G 1–560（560 aa） Chain GA 1–560（560 aa） Chain H 1–560（560 aa） Chain HA 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8UMD Cryo-EM structure of a single subunit of a Counterclockwise-locked form of the Salmonella enterica Typhimurium flagellar C-ring. Deposited 2023-10-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8UMX Cryo-EM structure of a single subunit of a Clockwise-locked form of the Salmonella enterica Typhimurium flagellar C-ring. Deposited 2023-10-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8UOX Cryo-EM structure of a Counterclockwise locked form of the Salmonella enterica Typhimurium flagellar C-ring, with C34 symmetry applied Deposited 2023-10-20	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A1 1–560（560 aa） Chain A2 1–560（560 aa） Chain A3 1–560（560 aa） Chain A4 1–560（560 aa） Chain A5 1–560（560 aa） Chain A6 1–560（560 aa） Chain A7 1–560（560 aa） Chain A8 1–560（560 aa） Chain A9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8UPL Cryo-EM structure of a Clockwise locked form of the Salmonella enterica Typhimurium flagellar C-ring, with C34 symmetry applied Deposited 2023-10-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A1 1–560（560 aa） Chain A2 1–560（560 aa） Chain A3 1–560（560 aa） Chain A4 1–560（560 aa） Chain A5 1–560（560 aa） Chain A6 1–560（560 aa） Chain A7 1–560（560 aa） Chain A8 1–560（560 aa） Chain A9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8VIB CW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming single subunit of the C-ring from Salmonella Deposited 2024-01-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8VID CW Flagellar Switch Complex with extra density - FliF, FliG, FliM, and FliN forming single subunit of the C-ring from Salmonella Deposited 2024-01-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8VKQ CW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming the C-ring from Salmonella Deposited 2024-01-09	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8VKR CW Flagellar Switch Complex with extra density - FliF, FliG, FliM, and FliN forming the C-ring from Salmonella Deposited 2024-01-09	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8WIW Cryo-EM structure of the flagellar C ring in the CW state Deposited 2023-09-25	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 238 PDB declaration: 238-meric	Chain A2 1–560（560 aa） Chain A9 1–560（560 aa） Chain B0 1–560（560 aa） Chain B3 1–560（560 aa） Chain BF 1–560（560 aa） Chain BM 1–560（560 aa） Chain BT 1–560（560 aa） Chain Ba 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bo 1–560（560 aa） Chain Bv 1–560（560 aa） Chain C 1–560（560 aa） Chain CG 1–560（560 aa） Chain CN 1–560（560 aa） Chain CU 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cw 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 5.60 Å
8WJR Cryo-EM structure of the MS ring (C34) within the flagellar motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 2.90 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WK4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.70 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain 0 1–560（560 aa） Chain 1 1–560（560 aa） Chain 2 1–560（560 aa） Chain 3 1–560（560 aa） Chain 4 1–560（560 aa） Chain 5 1–560（560 aa） Chain 6 1–560（560 aa） Chain 7 1–560（560 aa） Chain 8 1–560（560 aa） Chain 9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa） Chain t 1–560（560 aa） Chain u 1–560（560 aa） Chain v 1–560（560 aa） Chain w 1–560（560 aa） Chain x 1–560（560 aa） Chain y 1–560（560 aa） Chain z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLI Cryo-EM structure of the MS ring (C34) within the flagellar motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.20 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain 0 1–560（560 aa） Chain 1 1–560（560 aa） Chain 2 1–560（560 aa） Chain 3 1–560（560 aa） Chain 4 1–560（560 aa） Chain 5 1–560（560 aa） Chain 6 1–560（560 aa） Chain 7 1–560（560 aa） Chain 8 1–560（560 aa） Chain 9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa） Chain t 1–560（560 aa） Chain u 1–560（560 aa） Chain v 1–560（560 aa） Chain w 1–560（560 aa） Chain x 1–560（560 aa） Chain y 1–560（560 aa） Chain z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain B6 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain Bb 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bn 1–560（560 aa） Chain Bt 1–560（560 aa） Chain Bz 1–560（560 aa） Chain C3 1–560（560 aa） Chain C7 1–560（560 aa） Chain CB 1–560（560 aa） Chain CH 1–560（560 aa） Chain CN 1–560（560 aa） Chain CT 1–560（560 aa） Chain CZ 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cx 1–560（560 aa） Chain D2 1–560（560 aa） Chain D8 1–560（560 aa） Chain DE 1–560（560 aa） Chain DK 1–560（560 aa） Chain DR 1–560（560 aa） Chain DX 1–560（560 aa） Chain Dd 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dv 1–560（560 aa） Chain EF 1–560（560 aa） Chain EL 1–560（560 aa） Chain ER 1–560（560 aa） Chain EX 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Eh 1–560（560 aa） Chain En 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain B0 1–560（560 aa） Chain B3 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain Ba 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bo 1–560（560 aa） Chain Bv 1–560（560 aa） Chain CG 1–560（560 aa） Chain CN 1–560（560 aa） Chain CU 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cw 1–560（560 aa） Chain DE 1–560（560 aa） Chain DL 1–560（560 aa） Chain EH 1–560（560 aa） Chain EO 1–560（560 aa） Chain EV 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Eh 1–560（560 aa） Chain Ei 1–560（560 aa） Chain Ej 1–560（560 aa） Chain Ek 1–560（560 aa） Chain El 1–560（560 aa） Chain Em 1–560（560 aa） Chain En 1–560（560 aa） Chain Eo 1–560（560 aa） Chain Ep 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
8XP0 Cryo-EM structure of the protomers of the C ring in the CCW state Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain N 1–560（560 aa） Chain T 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 4.00 Å
8XP1 Cryo-EM structure of the protomers of the C ring in the CW state Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.40 Å
8YJT Cryo-EM structure of the flagellar C ring in the CCW state Deposited 2024-03-02	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain 0 1–560（560 aa） Chain 4 1–560（560 aa） Chain A2 1–560（560 aa） Chain A8 1–560（560 aa） Chain AF 1–560（560 aa） Chain AL 1–560（560 aa） Chain AR 1–560（560 aa） Chain AX 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ap 1–560（560 aa） Chain Av 1–560（560 aa） Chain B6 1–560（560 aa） Chain BD 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BP 1–560（560 aa） Chain BV 1–560（560 aa） Chain Bb 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bn 1–560（560 aa） Chain Bt 1–560（560 aa） Chain Bz 1–560（560 aa） Chain CB 1–560（560 aa） Chain CH 1–560（560 aa） Chain CN 1–560（560 aa） Chain CT 1–560（560 aa） Chain CZ 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cx 1–560（560 aa） Chain l 1–560（560 aa） Chain r 1–560（560 aa） Chain x 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 5.90 Å
8ZDS Structure of the Salmonella flagellar MS-ring with C11 symmetry applied Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8ZDT Structure of the RBM3 ring of Salmonella flagellar MS-ring protein FliF with C33 symmetry applied Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
8ZDU Structure of the RBM3 ring of Salmonella flagellar MS-ring protein FliF with C34 symmetry applied Deposited 2024-05-03	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9N49 C-ring - single subunit of the 34-mer CCW flagellar switch complex - FliF, FliG, FliM, and FliN from Salmonella Deposited 2025-02-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9N4Z CCW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming 34-mer C-ring from Salmonella Deposited 2025-02-03	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

47 other PDB entries and 47 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A1； PDBConstruct 1–560； UniProt 1–560 Author chain B1； PDBConstruct 1–560； UniProt 1–560 Author chain C1； PDBConstruct 1–560； UniProt 1–560 Author chain D1； PDBConstruct 1–560； UniProt 1–560 Author chain E1； PDBConstruct 1–560； UniProt 1–560 Author chain F1； PDBConstruct 1–560； UniProt 1–560 Author chain G1； PDBConstruct 1–560； UniProt 1–560 Author chain H1； PDBConstruct 1–560； UniProt 1–560 Author chain I1； PDBConstruct 1–560； UniProt 1–560 Author chain J1； PDBConstruct 1–560； UniProt 1–560 Author chain K1； PDBConstruct 1–560； UniProt 1–560 Author chain L1； PDBConstruct 1–560； UniProt 1–560 Author chain M1； PDBConstruct 1–560； UniProt 1–560 Author chain N1； PDBConstruct 1–560； UniProt 1–560 Author chain O1； PDBConstruct 1–560； UniProt 1–560 Author chain P1； PDBConstruct 1–560； UniProt 1–560 Author chain Q1； PDBConstruct 1–560； UniProt 1–560 Author chain R1； PDBConstruct 1–560； UniProt 1–560 Author chain S1； PDBConstruct 1–560； UniProt 1–560 Author chain T1； PDBConstruct 1–560； UniProt 1–560 Author chain U1； PDBConstruct 1–560； UniProt 1–560 Author chain V1； PDBConstruct 1–560； UniProt 1–560 Author chain W1； PDBConstruct 1–560； UniProt 1–560 Author chain X1； PDBConstruct 1–560； UniProt 1–560 Author chain Y1； PDBConstruct 1–560； UniProt 1–560 Author chain Z1； PDBConstruct 1–560； UniProt 1–560 Author chain a1； PDBConstruct 1–560； UniProt 1–560 Author chain b1； PDBConstruct 1–560； UniProt 1–560 Author chain c1； PDBConstruct 1–560； UniProt 1–560 Author chain d1； PDBConstruct 1–560； UniProt 1–560 Author chain e1； PDBConstruct 1–560； UniProt 1–560 Author chain f1； PDBConstruct 1–560； UniProt 1–560 Author chain g1； PDBConstruct 1–560； UniProt 1–560 Author chain h1； PDBConstruct 1–560； UniProt 1–560

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt A0A0D6FLD2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain A2； UniProt 1–245 Chain B2； UniProt 1–245 Chain C2； UniProt 1–245 Chain D2； UniProt 1–245 Chain E2； UniProt 1–245	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0D6FLD2_SALTM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A2； PDBConstruct 1–245； UniProt 1–245 Author chain B2； PDBConstruct 1–245； UniProt 1–245 Author chain C2； PDBConstruct 1–245； UniProt 1–245 Author chain D2； PDBConstruct 1–245； UniProt 1–245 Author chain E2； PDBConstruct 1–245； UniProt 1–245

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt A0A0D6FLB3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain F2； UniProt 1–264	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0D6FLB3_SALTM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F2； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt A0A0F7J7J8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain G2； UniProt 1–89 Chain H2； UniProt 1–89 Chain I2； UniProt 1–89 Chain J2； UniProt 1–89	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0F7J7J8_SALTM
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G2； PDBConstruct 1–89； UniProt 1–89 Author chain H2； PDBConstruct 1–89； UniProt 1–89 Author chain I2； PDBConstruct 1–89； UniProt 1–89 Author chain J2； PDBConstruct 1–89； UniProt 1–89

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt A0A0D6FLN2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain K2； UniProt 1–104 Chain L2； UniProt 1–104 Chain M2； UniProt 1–104 Chain N2； UniProt 1–104 Chain O2； UniProt 1–104 Chain P2； UniProt 1–104	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0D6FLN2_SALTM
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain K2； PDBConstruct 1–104； UniProt 1–104 Author chain L2； PDBConstruct 1–104； UniProt 1–104 Author chain M2； PDBConstruct 1–104； UniProt 1–104 Author chain N2； PDBConstruct 1–104； UniProt 1–104 Author chain O2； PDBConstruct 1–104； UniProt 1–104 Author chain P2； PDBConstruct 1–104； UniProt 1–104

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt A0A0D6GKK7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain Q2； UniProt 1–138 Chain R2； UniProt 1–138 Chain S2； UniProt 1–138 Chain T2； UniProt 1–138 Chain U2； UniProt 1–138	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0D6GKK7_SALTM
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Q2； PDBConstruct 1–138； UniProt 1–138 Author chain R2； PDBConstruct 1–138； UniProt 1–138 Author chain S2； PDBConstruct 1–138； UniProt 1–138 Author chain T2； PDBConstruct 1–138； UniProt 1–138 Author chain U2； PDBConstruct 1–138； UniProt 1–138

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt A0A0F7J5J2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain V2； UniProt 1–134 Chain W2； UniProt 1–134 Chain X2； UniProt 1–134 Chain Y2； UniProt 1–134 Chain Z2； UniProt 1–134 Chain a2； UniProt 1–134	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0F7J5J2_SALTM
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain V2； PDBConstruct 1–134； UniProt 1–134 Author chain W2； PDBConstruct 1–134； UniProt 1–134 Author chain X2； PDBConstruct 1–134； UniProt 1–134 Author chain Y2； PDBConstruct 1–134； UniProt 1–134 Author chain Z2； PDBConstruct 1–134； UniProt 1–134 Author chain a2； PDBConstruct 1–134； UniProt 1–134

Flagellar basal body protein

OrganismNot specified

UniProt A0A0D6GIC9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain b2； UniProt 1–251 Chain c2； UniProt 1–251 Chain d2； UniProt 1–251 Chain e2； UniProt 1–251 Chain f2； UniProt 1–251	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0D6GIC9_SALTM
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain b2； PDBConstruct 1–251； UniProt 1–251 Author chain c2； PDBConstruct 1–251； UniProt 1–251 Author chain d2； PDBConstruct 1–251； UniProt 1–251 Author chain e2； PDBConstruct 1–251； UniProt 1–251 Author chain f2； PDBConstruct 1–251； UniProt 1–251

Flagellar basal-body rod protein FlgG

OrganismNot specified

UniProt A0A0F7J893

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain 12； UniProt 1–260 Chain 22； UniProt 1–260 Chain 32； UniProt 1–260 Chain 42； UniProt 1–260 Chain g2； UniProt 1–260 Chain h2； UniProt 1–260 Chain i2； UniProt 1–260 Chain j2； UniProt 1–260 Chain k2； UniProt 1–260 Chain l2； UniProt 1–260 Chain m2； UniProt 1–260 Chain n2； UniProt 1–260 Chain o2； UniProt 1–260 Chain p2； UniProt 1–260 Chain q2； UniProt 1–260 Chain r2； UniProt 1–260 Chain s2； UniProt 1–260 Chain t2； UniProt 1–260 Chain u2； UniProt 1–260 Chain v2； UniProt 1–260 Chain w2； UniProt 1–260 Chain x2； UniProt 1–260 Chain y2； UniProt 1–260 Chain z2； UniProt 1–260	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0F7J893_SALTM
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 12； PDBConstruct 1–260； UniProt 1–260 Author chain 22； PDBConstruct 1–260； UniProt 1–260 Author chain 32； PDBConstruct 1–260； UniProt 1–260 Author chain 42； PDBConstruct 1–260； UniProt 1–260 Author chain g2； PDBConstruct 1–260； UniProt 1–260 Author chain h2； PDBConstruct 1–260； UniProt 1–260 Author chain i2； PDBConstruct 1–260； UniProt 1–260 Author chain j2； PDBConstruct 1–260； UniProt 1–260 Author chain k2； PDBConstruct 1–260； UniProt 1–260 Author chain l2； PDBConstruct 1–260； UniProt 1–260 Author chain m2； PDBConstruct 1–260； UniProt 1–260 Author chain n2； PDBConstruct 1–260； UniProt 1–260 Author chain o2； PDBConstruct 1–260； UniProt 1–260 Author chain p2； PDBConstruct 1–260； UniProt 1–260 Author chain q2； PDBConstruct 1–260； UniProt 1–260 Author chain r2； PDBConstruct 1–260； UniProt 1–260 Author chain s2； PDBConstruct 1–260； UniProt 1–260 Author chain t2； PDBConstruct 1–260； UniProt 1–260 Author chain u2； PDBConstruct 1–260； UniProt 1–260 Author chain v2； PDBConstruct 1–260； UniProt 1–260 Author chain w2； PDBConstruct 1–260； UniProt 1–260 Author chain x2； PDBConstruct 1–260； UniProt 1–260 Author chain y2； PDBConstruct 1–260； UniProt 1–260 Author chain z2； PDBConstruct 1–260； UniProt 1–260

Flagellar L-ring protein

OrganismNot specified

UniProt A0A0J5DWE9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain A3； UniProt 1–232 Chain B3； UniProt 1–232 Chain C3； UniProt 1–232 Chain D3； UniProt 1–232 Chain E3； UniProt 1–232 Chain F3； UniProt 1–232 Chain G3； UniProt 1–232 Chain H3； UniProt 1–232 Chain I3； UniProt 1–232 Chain J3； UniProt 1–232 Chain K3； UniProt 1–232 Chain L3； UniProt 1–232 Chain M3； UniProt 1–232 Chain N3； UniProt 1–232 Chain O3； UniProt 1–232 Chain P3； UniProt 1–232 Chain Q3； UniProt 1–232 Chain R3； UniProt 1–232 Chain S3； UniProt 1–232 Chain T3； UniProt 1–232 Chain U3； UniProt 1–232 Chain V3； UniProt 1–232 Chain W3； UniProt 1–232 Chain X3； UniProt 1–232 Chain Y3； UniProt 1–232 Chain Z3； UniProt 1–232	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7NVG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CLR CryoEM structure of S.typhimurium flagellar LP ring Deposited 2020-07-21	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 52 PDB declaration: 52-meric	Chain A 1–232（232 aa） Chain B 1–232（232 aa） Chain C 1–232（232 aa） Chain D 1–232（232 aa） Chain E 1–232（232 aa） Chain F 1–232（232 aa） Chain G 1–232（232 aa） Chain H 1–232（232 aa） Chain I 1–232（232 aa） Chain J 1–232（232 aa） Chain K 1–232（232 aa） Chain L 1–232（232 aa） Chain M 1–232（232 aa） Chain N 1–232（232 aa） Chain O 1–232（232 aa） Chain P 1–232（232 aa） Chain Q 1–232（232 aa） Chain R 1–232（232 aa） Chain S 1–232（232 aa） Chain T 1–232（232 aa） Chain U 1–232（232 aa） Chain V 1–232（232 aa） Chain W 1–232（232 aa） Chain X 1–232（232 aa） Chain Y 1–232（232 aa） Chain Z 1–232（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0J5DWE9_SALTM
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A3； PDBConstruct 1–232； UniProt 1–232 Author chain B3； PDBConstruct 1–232； UniProt 1–232 Author chain C3； PDBConstruct 1–232； UniProt 1–232 Author chain D3； PDBConstruct 1–232； UniProt 1–232 Author chain E3； PDBConstruct 1–232； UniProt 1–232 Author chain F3； PDBConstruct 1–232； UniProt 1–232 Author chain G3； PDBConstruct 1–232； UniProt 1–232 Author chain H3； PDBConstruct 1–232； UniProt 1–232 Author chain I3； PDBConstruct 1–232； UniProt 1–232 Author chain J3； PDBConstruct 1–232； UniProt 1–232 Author chain K3； PDBConstruct 1–232； UniProt 1–232 Author chain L3； PDBConstruct 1–232； UniProt 1–232 Author chain M3； PDBConstruct 1–232； UniProt 1–232 Author chain N3； PDBConstruct 1–232； UniProt 1–232 Author chain O3； PDBConstruct 1–232； UniProt 1–232 Author chain P3； PDBConstruct 1–232； UniProt 1–232 Author chain Q3； PDBConstruct 1–232； UniProt 1–232 Author chain R3； PDBConstruct 1–232； UniProt 1–232 Author chain S3； PDBConstruct 1–232； UniProt 1–232 Author chain T3； PDBConstruct 1–232； UniProt 1–232 Author chain U3； PDBConstruct 1–232； UniProt 1–232 Author chain V3； PDBConstruct 1–232； UniProt 1–232 Author chain W3； PDBConstruct 1–232； UniProt 1–232 Author chain X3； PDBConstruct 1–232； UniProt 1–232 Author chain Y3； PDBConstruct 1–232； UniProt 1–232 Author chain Z3； PDBConstruct 1–232； UniProt 1–232

Flagellar P-ring protein

OrganismNot specified

UniProt A0A0F7J5J5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain a3； UniProt 1–365 Chain b3； UniProt 1–365 Chain c3； UniProt 1–365 Chain d3； UniProt 1–365 Chain e3； UniProt 1–365 Chain f3； UniProt 1–365 Chain g3； UniProt 1–365 Chain h3； UniProt 1–365 Chain i3； UniProt 1–365 Chain j3； UniProt 1–365 Chain k3； UniProt 1–365 Chain l3； UniProt 1–365 Chain m3； UniProt 1–365 Chain n3； UniProt 1–365 Chain o3； UniProt 1–365 Chain p3； UniProt 1–365 Chain q3； UniProt 1–365 Chain r3； UniProt 1–365 Chain s3； UniProt 1–365 Chain t3； UniProt 1–365 Chain u3； UniProt 1–365 Chain v3； UniProt 1–365 Chain w3； UniProt 1–365 Chain x3； UniProt 1–365 Chain y3； UniProt 1–365 Chain z3； UniProt 1–365	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7NVG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CLR CryoEM structure of S.typhimurium flagellar LP ring Deposited 2020-07-21	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 52 PDB declaration: 52-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F7J5J5_SALTM
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain a3； PDBConstruct 1–365； UniProt 1–365 Author chain b3； PDBConstruct 1–365； UniProt 1–365 Author chain c3； PDBConstruct 1–365； UniProt 1–365 Author chain d3； PDBConstruct 1–365； UniProt 1–365 Author chain e3； PDBConstruct 1–365； UniProt 1–365 Author chain f3； PDBConstruct 1–365； UniProt 1–365 Author chain g3； PDBConstruct 1–365； UniProt 1–365 Author chain h3； PDBConstruct 1–365； UniProt 1–365 Author chain i3； PDBConstruct 1–365； UniProt 1–365 Author chain j3； PDBConstruct 1–365； UniProt 1–365 Author chain k3； PDBConstruct 1–365； UniProt 1–365 Author chain l3； PDBConstruct 1–365； UniProt 1–365 Author chain m3； PDBConstruct 1–365； UniProt 1–365 Author chain n3； PDBConstruct 1–365； UniProt 1–365 Author chain o3； PDBConstruct 1–365； UniProt 1–365 Author chain p3； PDBConstruct 1–365； UniProt 1–365 Author chain q3； PDBConstruct 1–365； UniProt 1–365 Author chain r3； PDBConstruct 1–365； UniProt 1–365 Author chain s3； PDBConstruct 1–365； UniProt 1–365 Author chain t3； PDBConstruct 1–365； UniProt 1–365 Author chain u3； PDBConstruct 1–365； UniProt 1–365 Author chain v3； PDBConstruct 1–365； UniProt 1–365 Author chain w3； PDBConstruct 1–365； UniProt 1–365 Author chain x3； PDBConstruct 1–365； UniProt 1–365 Author chain y3； PDBConstruct 1–365； UniProt 1–365 Author chain z3； PDBConstruct 1–365； UniProt 1–365

Basal-body rod modification protein FlgD

OrganismNot specified

UniProt A0A0F7J820

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 147 PDB declaration: 147-meric（147） Consistent with protein copy count	Chain A4； UniProt 1–232 Chain B4； UniProt 1–232 Chain C4； UniProt 1–232 Chain D4； UniProt 1–232 Chain E4； UniProt 1–232	Not recorded	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0F7J820_SALTM
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain A4； PDBConstruct 1–232； UniProt 1–232 Author chain B4； PDBConstruct 1–232； UniProt 1–232 Author chain C4； PDBConstruct 1–232； UniProt 1–232 Author chain D4； PDBConstruct 1–232； UniProt 1–232 Author chain E4； PDBConstruct 1–232； UniProt 1–232

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nvg
Deposition date deposition_date	2021-03-15
Structure title title	Salmonella flagellar basal body refined in C1 map
Keywords keywords	bacterial flagellum, flagella, basal body, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	115.70 Å
Forward intensity I(0) i0	178321000000.00
Molecular weight molecular_weight	3509200.0 kDa
Excluded volume excluded_volume	4355400 Å³
Envelope volume envelope_volume	7201700 Å³
Hydration-shell volume shell_volume	483210 Å³
Envelope diameter envelope_diameter	379.2 Å
Shell Rg shell_rg	114.10 Å
Envelope Rg envelope_rg	115.60 Å
Shape Rg shape_rg	115.80 Å
Total Rg total_rg	115.60 Å
Total atoms total_atoms	246310
Residues n_residues	32749
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	303.4 Å
Rg (real space) rg_real	112.00 Å
Rg uncertainty (real space) rg_real_error	0.88 Å
I(0) (real space) i0_real	1.7110e+11
I(0) uncertainty (real space) i0_real_error	3.5700e+09
Rg (reciprocal space) rg_reciprocal	112.90 Å
I(0) (reciprocal space) i0_reciprocal	176600000000.0000
Solution quality estimate total_estimate	0.9131
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	116.7 Å
Skewness Skewness skewness	0.236
Kurtosis Kurtosis kurtosis	-0.718
Angular range angular_range	— – 0.0650 Å⁻¹
Current regularization parameter α current_alpha	1.0530
Highest regularization parameter α highest_alpha	12970000000.0000
Real-space data points n_real_points	14
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 1.000; Stabil: 0.969; Sysdev: 1.000; Positv: 1.000; Valcen: 0.966; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,B1,C1,D1,E1,F1,G1,H1,I1,J1,K1,L1,M1,N1,O1,P1,Q1,R1,S1,T1,U1,V1,W1,X1,Y1,Z1,a1,b1,c1,d1,e1,f1,g1,h1
Atom count atom_count	246311

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 2 Entity 2 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2,B2,C2,D2,E2

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F2

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 4 Entity 4 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G2,H2,I2,J2

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 5 Entity 5 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K2,L2,M2,N2,O2,P2

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 6 Entity 6 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q2,R2,S2,T2,U2

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 7 Entity 7 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V2,W2,X2,Y2,Z2,a2

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

Entity 8 Entity 8 polymer

Description description	Flagellar basal body protein
Molecular weight formula_weight	26121.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b2,c2,d2,e2,f2

MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDPPNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSMS

Entity 9 Entity 9 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27784.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g2,h2,i2,j2,k2,l2,m2,n2,o2,p2,q2,r2,s2,t2,u2,v2,w2,x2,y2,z2,12,22,32,42

MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL

Entity 10 Entity 10 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24726.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3,B3,C3,D3,E3,F3,G3,H3,I3,J3,K3,L3,M3,N3,O3,P3,Q3,R3,S3,T3,U3,V3,W3,X3,Y3,Z3

MQKYALHAYPVMALMVATLTGCAWIPAKPLVQGATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

Entity 11 Entity 11 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	38194.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a3,b3,c3,d3,e3,f3,g3,h3,i3,j3,k3,l3,m3,n3,o3,p3,q3,r3,s3,t3,u3,v3,w3,x3,y3,z3

MFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRGGTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQFGAGNTINLQLNDEDFTMAQQITDAINRARGYGSATALDARTVQVRVPSGNSSQVRFLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPNTPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQSAGCLRAKLEII

Entity 12 Entity 12 polymer

Description description	Basal-body rod modification protein FlgD
Molecular weight formula_weight	24001.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A4,B4,C4,D4,E4

MSIAVNMNDPTNTGVKTTTGSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGIEKLNTTLGAISGQIDNSQSLQATTLIGHGVMVPGTTILAGKGAEEGAVTSTTPFGVELQQPADKVTATITDKDGRVVRTLEIGELRAGVHTFTWDGKQTDGTTVPNGSYNIAITASNGGTQLVAQPLQFALVQGVTKGSNGNLLDLGTYGTTTLDEVRQII

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	60497

fit	/app/data/saxs_computation/nv/7nvg/7nvg.fit
pddf	/app/data/pr_computation/nv/7nvg/7nvg.pr.out
profile	/app/data/saxs_computation/nv/7nvg/7nvg.dat

Salmonella flagellar basal body refined in C1 map

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal body protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Basal-body rod modification protein FlgD

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)