8q7n

cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Splicing factor 3A subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 7； PDBConstruct 1–793； UniProt 1–793

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–972； UniProt 1–972

Thioredoxin-like protein 4A

OrganismNot specified

UniProt P83876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXN4A_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–142； UniProt 1–142

Pre-mRNA-splicing factor 38A

OrganismNot specified

UniProt Q8NAV1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PR38A_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain I； PDBConstruct 1–312； UniProt 1–312

Microfibrillar-associated protein 1

OrganismNot specified

UniProt P55081

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MFAP1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain K； PDBConstruct 1–439； UniProt 1–439

NHP2-like protein 1, N-terminally processed

OrganismNot specified

UniProt P55769

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NH2L1_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain M； PDBConstruct 1–128； UniProt 1–128

Protein BUD31 homolog

OrganismNot specified

UniProt P41223

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD31_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Q； PDBConstruct 1–144； UniProt 1–144

WW domain-binding protein 4

OrganismNot specified

UniProt O75554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	WBP4_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain X； PDBConstruct 1–376； UniProt 1–376

Zinc finger matrin-type protein 2

OrganismNot specified

UniProt Q96NC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ZMAT2_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain r； PDBConstruct 1–199； UniProt 1–199

Ubiquitin-like protein 5

OrganismNot specified

UniProt Q9BZL1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UBL5_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain s； PDBConstruct 1–73； UniProt 1–73

U4/U6 small nuclear ribonucleoprotein Prp31

OrganismNot specified

UniProt Q8WWY3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain L； PDBConstruct 1–499； UniProt 1–499

U4/U6 small nuclear ribonucleoprotein Prp4

OrganismNot specified

UniProt O43172

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain F； PDBConstruct 1–522； UniProt 1–522

Pre-mRNA-processing factor 6

OrganismNot specified

UniProt O94906

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP6_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain N； PDBConstruct 1–941； UniProt 1–941

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

U4/U6.U5 tri-snRNP-associated protein 1

OrganismNot specified

UniProt O43290

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT1_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain S； PDBConstruct 1–800； UniProt 1–800

Transcription elongation regulator 1

OrganismNot specified

UniProt O14776

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCRG1_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain T； PDBConstruct 1–1098； UniProt 1–1098

U4/U6 small nuclear ribonucleoprotein Prp3

OrganismNot specified

UniProt O43395

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 4	U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 1 × 1 （Q15459） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Microfibrillar-associated protein 1 × 1 （P55081） NHP2-like protein 1, N-terminally processed × 1 （P55769） Protein BUD31 homolog × 1 （P41223） WW domain-binding protein 4 × 1 （O75554） MINX pre-mRNA × 1 Zinc finger matrin-type protein 2 × 1 （Q96NC0） Ubiquitin-like protein 5 × 1 （Q9BZL1） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Transcription elongation regulator 1 × 1 （O14776） U4 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRPF3_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain J； PDBConstruct 1–683； UniProt 1–683

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8q7n
Deposition date deposition_date	2023-08-16
Structure title title	cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
Keywords keywords	spliceosome, pre-catalytic spliceosome, spliceosomal B complex, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8q7n__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8q7n__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8q7n__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.57 Å
Rg (electron density)	71.47 Å
Total Rg	71.33 Å
Atom count	55463
Residues	6865
Excluded volume	954400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8q7n__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	U5 snRNA
Molecular weight formula_weight	37254.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5
Atom count atom_count	55463

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Entity 2 Entity 2 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Entity 3 Entity 3 polymer

Description description	Splicing factor 3A subunit 1
Molecular weight formula_weight	88991.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK

Entity 4 Entity 4 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 5 Entity 5 polymer

Description description	Thioredoxin-like protein 4A
Molecular weight formula_weight	16807.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Entity 6 Entity 6 polymer

Description description	Pre-mRNA-splicing factor 38A
Molecular weight formula_weight	37563.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPRVSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPRRRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRGNE

Entity 7 Entity 7 polymer

Description description	Microfibrillar-associated protein 1
Molecular weight formula_weight	52050.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSVPSALMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEFQFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVVGESDSEVEGDAWRMEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESESESEYEEYTDSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYTLKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKTT

Entity 8 Entity 8 polymer

Description description	NHP2-like protein 1, N-terminally processed
Molecular weight formula_weight	14191.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Entity 9 Entity 9 polymer

Description description	Protein BUD31 homolog
Molecular weight formula_weight	17032.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Entity 10 Entity 10 polymer

Description description	WW domain-binding protein 4
Molecular weight formula_weight	42575.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRRTENGKSRNLRQRGDDQ

Entity 11 Entity 11 polymer

Description description	MINX pre-mRNA
Molecular weight formula_weight	111300.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

GGUACCUAAUACGACUCACUAUAGGGAGACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGCUUGCUGCACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUCCUGUCCCUUUUUUUUCCACAGCUCGCGGUUGAGGACAAACUCUUCGCGGUCUUUCCAGUGGGGAUCCAAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGA

Entity 12 Entity 12 polymer

Description description	Zinc finger matrin-type protein 2
Molecular weight formula_weight	23664.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY

Entity 13 Entity 13 polymer

Description description	Ubiquitin-like protein 5
Molecular weight formula_weight	8560.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ

Entity 14 Entity 14 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp31
Molecular weight formula_weight	55529.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Entity 15 Entity 15 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp4
Molecular weight formula_weight	58536.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

Entity 16 Entity 16 polymer

Description description	Pre-mRNA-processing factor 6
Molecular weight formula_weight	107092.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF

Entity 17 Entity 17 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 18 Entity 18 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 1
Molecular weight formula_weight	90414.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQKTPYIVLSGSGKSMNANTITK

Entity 19 Entity 19 polymer

Description description	Transcription elongation regulator 1
Molecular weight formula_weight	124083.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMPPVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEPSEEPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK

Entity 20 Entity 20 polymer

Description description	U4 snRNA
Molecular weight formula_weight	46528.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUUUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUACCCCGCCGUGACGACUUGCAAUAUAGUCGGCAUUGGCAAUUUUUGACAGUCUCUACGGAGACUGG

Entity 21 Entity 21 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp3
Molecular weight formula_weight	77669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

▶

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	251564

cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Splicing factor 3A subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

116 kDa U5 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Thioredoxin-like protein 4A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor 38A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Microfibrillar-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NHP2-like protein 1, N-terminally processed

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein BUD31 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

WW domain-binding protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Zinc finger matrin-type protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquitin-like protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer