SAXSdb — 9on8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein p24

Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	INOSITOL HEXAKISPHOSPHATE × 1 1-{(2R)-2-(4-tert-butylphenyl)-2-[(2,3-dihydro-1H-inden-2-yl)amino]ethyl}-3-(trifluoromethyl)pyridin-2(1H)-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POL_HV1N5
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain G； PDBConstruct 3–102； UniProt 278–377 Author chain H； PDBConstruct 3–102； UniProt 278–377 Author chain I； PDBConstruct 3–102； UniProt 278–377 Author chain J； PDBConstruct 3–102； UniProt 278–377 Author chain K； PDBConstruct 3–102； UniProt 278–377 Author chain L； PDBConstruct 3–102； UniProt 278–377

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9on8
Deposition date deposition_date	2025-05-14
Last revision last_revision	2025-10-08
Structure title title	Immature HIV-1 CACTD-SP1 lattice with Maturation inhibitor PF-46396 (R) and Inositol hexakisphosphate (IP6)
Keywords keywords	HIV-1, maturation inhibitors, PF-46396, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	SOLID-STATE NMR

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9on8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9on8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9on8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	27.55 Å
Rg (electron density)	26.68 Å
Total Rg	27.54 Å
Atom count	9410
Residues	612
Excluded volume	83413 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9on8__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`9on8__assembly_1__model_2`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`9on8__assembly_1__model_3`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`9on8__assembly_1__model_4`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`9on8__assembly_1__model_5`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`9on8__assembly_1__model_6`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`9on8__assembly_1__model_7`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	8	`9on8__assembly_1__model_8`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	9	`9on8__assembly_1__model_9`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	10	`9on8__assembly_1__model_10`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Capsid protein p24
Molecular weight formula_weight	11094.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L
Atom count atom_count	94100

GGSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVLAEAMSQVTNTATIM

Source Source

Source organism organism	Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)
NCBI taxonomy ID ncbi_taxonomy_id	11698
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	1-{(2R)-2-(4-tert-butylphenyl)-2-[(2,3-dihydro-1H-inden-2-yl)amino]ethyl}-3-(trifluoromethyl)pyridin-2(1H)-one
Molecular weight formula_weight	454.5 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Immature HIV-1 CACTD-SP1 lattice with Maturation inhibitor PF-46396 (R) and Inositol hexakisphosphate (IP6)