8h6e

Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U6 snRNA-associated Sm-like protein LSm2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 6a； PDBConstruct 1–95； UniProt 1–95

U6 snRNA-associated Sm-like protein LSm3

OrganismNot specified

UniProt P62310

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 6b； PDBConstruct 1–102； UniProt 1–102

U6 snRNA-associated Sm-like protein LSm4

OrganismNot specified

UniProt Q9Y4Z0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 6c； PDBConstruct 1–139； UniProt 1–139

U6 snRNA-associated Sm-like protein LSm5

OrganismNot specified

UniProt Q9Y4Y9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 6d； PDBConstruct 1–91； UniProt 1–91

U6 snRNA-associated Sm-like protein LSm6

OrganismNot specified

UniProt P62312

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 6e； PDBConstruct 1–80； UniProt 1–80

U6 snRNA-associated Sm-like protein LSm7

OrganismNot specified

UniProt Q9UK45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 6f； PDBConstruct 1–103； UniProt 1–103

U6 snRNA-associated Sm-like protein LSm8

OrganismNot specified

UniProt O95777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 6g； PDBConstruct 1–96； UniProt 1–96

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 5B； PDBConstruct 1–2335； UniProt 1–2335

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 5C； PDBConstruct 1–972； UniProt 1–972

U5 small nuclear ribonucleoprotein 200 kDa helicase

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 5D； PDBConstruct 1–2136； UniProt 1–2136

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 5E； PDBConstruct 1–357； UniProt 1–357

;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	P14678-2
PDB entities	15
Chains and sequence ranges	Author chain 2a； PDBConstruct 1–231； UniProt 1–231 Author chain 4a； PDBConstruct 1–231； UniProt 1–231 Author chain 5a； PDBConstruct 1–231； UniProt 1–231

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 2b； PDBConstruct 1–119； UniProt 1–119 Author chain 4b； PDBConstruct 1–119； UniProt 1–119 Author chain 5b； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 2c； PDBConstruct 1–118； UniProt 1–118 Author chain 4c； PDBConstruct 1–118； UniProt 1–118 Author chain 5c； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 2d； PDBConstruct 1–86； UniProt 1–86 Author chain 4d； PDBConstruct 1–86； UniProt 1–86 Author chain 5d； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 2e； PDBConstruct 1–92； UniProt 1–92 Author chain 4e； PDBConstruct 1–92； UniProt 1–92 Author chain 5e； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 2f； PDBConstruct 1–76； UniProt 1–76 Author chain 4f； PDBConstruct 1–76； UniProt 1–76 Author chain 5f； PDBConstruct 1–76； UniProt 1–76

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 2g； PDBConstruct 1–126； UniProt 1–126 Author chain 4g； PDBConstruct 1–126； UniProt 1–126 Author chain 5g； PDBConstruct 1–126； UniProt 1–126

U4/U6 small nuclear ribonucleoprotein Prp3

OrganismNot specified

UniProt O43395

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRPF3_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 4B； PDBConstruct 1–683； UniProt 1–683

U4/U6 small nuclear ribonucleoprotein Prp4

OrganismNot specified

UniProt O43172

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 4C； PDBConstruct 1–522； UniProt 1–522

U4/U6 small nuclear ribonucleoprotein Prp31

OrganismNot specified

UniProt Q8WWY3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain 4D； PDBConstruct 1–499； UniProt 1–499

NHP2-like protein 1

OrganismNot specified

UniProt P55769

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NH2L1_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 4E； PDBConstruct 1–128； UniProt 1–128

Thioredoxin-like protein 4A

OrganismNot specified

UniProt P83876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXN4A_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 4F； PDBConstruct 1–142； UniProt 1–142

Pre-mRNA-processing factor 6

OrganismNot specified

UniProt O94906

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP6_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 4G； PDBConstruct 1–941； UniProt 1–941

RNA-binding protein 42

OrganismNot specified

UniProt Q9BTD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM42_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 4R； PDBConstruct 1–480； UniProt 1–480

U4/U6.U5 tri-snRNP-associated protein 1

OrganismNot specified

UniProt O43290

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT1_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 4S； PDBConstruct 1–800； UniProt 1–800

U4/U6.U5 tri-snRNP-associated protein 2

OrganismNot specified

UniProt Q53GS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT2_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain 4T； PDBConstruct 1–565； UniProt 1–565

Probable ATP-dependent RNA helicase DDX23

OrganismNot specified

UniProt Q9BUQ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DDX23_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain 4U； PDBConstruct 1–820； UniProt 1–820

U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein

OrganismNot specified

UniProt Q8WVK2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR27_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain 4X； PDBConstruct 1–155； UniProt 1–155

Serine/threonine-protein kinase PRP4 homolog

OrganismNot specified

UniProt Q13523

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4B_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain 4Y； PDBConstruct 1–1007； UniProt 1–1007

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt P09661

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain 2B； PDBConstruct 1–255； UniProt 1–255

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P08579

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2B_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain 2C； PDBConstruct 1–225； UniProt 1–225

Splicing factor 3A subunit 1

OrganismNot specified

UniProt Q15459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A1_HUMAN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain 2D； PDBConstruct 1–793； UniProt 1–793

Splicing factor 3A subunit 2

OrganismNot specified

UniProt Q15428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A2_HUMAN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain 2E； PDBConstruct 1–464； UniProt 1–464

Splicing factor 3A subunit 3

OrganismNot specified

UniProt Q12874

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A3_HUMAN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain 2F； PDBConstruct 1–501； UniProt 1–501

Splicing factor 3B subunit 1

OrganismNot specified

UniProt O75533

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain 2G； PDBConstruct 1–1304； UniProt 1–1304

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain 2H； PDBConstruct 1–895； UniProt 1–895

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain 2I； PDBConstruct 1–1217； UniProt 1–1217

Splicing factor 3B subunit 4

OrganismNot specified

UniProt Q15427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B4_HUMAN
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain 2J； PDBConstruct 1–424； UniProt 1–424

Splicing factor 3B subunit 6

OrganismNot specified

UniProt Q9Y3B4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B6_HUMAN
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain 2K； PDBConstruct 1–125； UniProt 1–125

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain 2L； PDBConstruct 1–110； UniProt 1–110

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 56 RNA 5	pre-mRNA × 1 U6 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） U4 snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） NHP2-like protein 1 × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） Pre-mRNA-processing factor 6 × 1 （O94906） RNA-binding protein 42 × 1 （Q9BTD8） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） INOSITOL HEXAKISPHOSPHATE × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain 2M； PDBConstruct 1–86； UniProt 1–86

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8h6e
Deposition date deposition_date	2022-10-17
Structure title title	Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.
Keywords keywords	exon-defined spliceosome, late pre-B state, RNA splicing, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8h6e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8h6e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8h6e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	114.60 Å
Total Rg	113.20 Å
Atom count	96125
Residues	14779
Excluded volume	1572500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8h6e__assembly_1__model_1`	61-meric （61）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (51)

Entity 1 Entity 1 polymer

Description description	pre-mRNA
Molecular weight formula_weight	45961.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	96125

GGGAGGUUUCCUUGAAGCUUUCGUGCUGACCCUGUCCCUUUUUUUUCCACAGGGGCGAAUUCGAGCUCACUCUCUUCCGCAUCGCUGUCUGCGAGGUACCCUACCAGGUGAGUAUGGAUCCCUCUAAAAGCGGGCAUGACUUCU

Entity 2 Entity 2 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34404.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6A

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUUU

Entity 3 Entity 3 polymer

Description description	U6 snRNA-associated Sm-like protein LSm2
Molecular weight formula_weight	10847.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6a

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Entity 4 Entity 4 polymer

Description description	U6 snRNA-associated Sm-like protein LSm3
Molecular weight formula_weight	11859.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6b

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Entity 5 Entity 5 polymer

Description description	U6 snRNA-associated Sm-like protein LSm4
Molecular weight formula_weight	15375.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6c

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Entity 6 Entity 6 polymer

Description description	U6 snRNA-associated Sm-like protein LSm5
Molecular weight formula_weight	9945.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6d

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Entity 7 Entity 7 polymer

Description description	U6 snRNA-associated Sm-like protein LSm6
Molecular weight formula_weight	9139.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6e

MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

Entity 8 Entity 8 polymer

Description description	U6 snRNA-associated Sm-like protein LSm7
Molecular weight formula_weight	11617.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6f

MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA

Entity 9 Entity 9 polymer

Description description	U6 snRNA-associated Sm-like protein LSm8
Molecular weight formula_weight	10410.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6g

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

Entity 10 Entity 10 polymer

Description description	U5 snRNA
Molecular weight formula_weight	37254.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5A

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Entity 11 Entity 11 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5B

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 12 Entity 12 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5C

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 13 Entity 13 polymer

Description description	U5 small nuclear ribonucleoprotein 200 kDa helicase
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5D

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 14 Entity 14 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5E

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 15 Entity 15 polymer

Description description	;Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	23686.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5a,4a,2a

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL

Entity 16 Entity 16 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5b,4b,2b

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 17 Entity 17 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5c,4c,2c

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 18 Entity 18 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5d,4d,2d

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 19 Entity 19 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5e,4e,2e

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 20 Entity 20 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5f,4f,2f

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 21 Entity 21 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5g,4g,2g

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 22 Entity 22 polymer

Description description	U4 snRNA
Molecular weight formula_weight	46995.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4A

XAGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUCUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUACCCCGCCGUGACGACUUGCAAUAUAGUCGGCACUGGCAAUUUUUGACAGUCUCUACGGAGACUGG

Entity 23 Entity 23 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp3
Molecular weight formula_weight	77669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4B

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

Entity 24 Entity 24 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp4
Molecular weight formula_weight	58536.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4C

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

Entity 25 Entity 25 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp31
Molecular weight formula_weight	55529.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4D

MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Entity 26 Entity 26 polymer

Description description	NHP2-like protein 1
Molecular weight formula_weight	14191.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4E

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Entity 27 Entity 27 polymer

Description description	Thioredoxin-like protein 4A
Molecular weight formula_weight	16807.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4F

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Entity 28 Entity 28 polymer

Description description	Pre-mRNA-processing factor 6
Molecular weight formula_weight	107092.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4G

MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF

Entity 29 Entity 29 polymer

Description description	RNA-binding protein 42
Molecular weight formula_weight	50477.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4R

MAGAGPAPGLPGAGGPVVPGPGAGIPGKSGEERLKEMEAEMALFEQEVLGAPVPGIPTAVPAVPTVPTVPTVEAMQVPAAPVIRPIIATNTYQQVQQTLEARAAAAATVVPPMVGGPPFVGPVGFGPGDRSHLDSPEAREAMFLRRAAVAPQRAPILRPAFVPHVLQRADSALSSAAAGPRPMALRPPHQALVGPPLPGPPGPPMMLPPMARAPGPPLGSMAALRPPLEEPAAPRELGLGLGLGLKEKEEAVVAAAAGLEEASAAVAVGAGGAPAGPAVIGPSLPLALAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

Entity 30 Entity 30 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 1
Molecular weight formula_weight	90414.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4S

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQKTPYIVLSGSGKSMNANTITK

Entity 31 Entity 31 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 2
Molecular weight formula_weight	65481.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4T

MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA

Entity 32 Entity 32 polymer

Description description	Probable ATP-dependent RNA helicase DDX23
Molecular weight formula_weight	95785.1 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4U

MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Entity 33 Entity 33 polymer

Description description	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein
Molecular weight formula_weight	18915.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4X

MGRSRSRSPRRERRRSRSTSRERERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA

Entity 34 Entity 34 polymer

Description description	Serine/threonine-protein kinase PRP4 homolog
Molecular weight formula_weight	117265.0 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4Y

MAAAETQSLREQPEMEDANSEKSINEENGEVSEDQSQNKHSRHKKKKHKHRSKHKKHKHSSEEDKDKKHKHKHKHKKHKRKEIIDASDKEGMSPAKRTKLDDLALLEDLEKQRALIKAELDNELMEGKVQSGMGLILQGYESGSEEEGEIHEKARNGNRSSTRSSSTKGKLELVDNKITTKKRSKSRSKERTRHRSDKKKSKGGIEIVKEKTTRSKSKERKKSKSPSKRSKSQDQARKSKSPTLRRRSQEKIGKARSPTDDKVKIEDKSKSKDRKKSPIINESRSRDRGKKSRSPVDLRGKSKDRRSRSKERKSKRSETDKEKKPIKSPSKDASSGKENRSPSRRPGRSPKRRSLSPKPRDKSRRSRSPLLNDRRSKQSKSPSRTLSPGRRAKSRSLERKRREPERRRLSSPRTRPRDDILSRRERSKDASPINRWSPTRRRSRSPIRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSRLRRRSRSRGGRRRRSRSKVKEDKFKGSLSEGMKVEQESSSDDNLEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQEKI

Entity 35 Entity 35 polymer

Description description	U2 snRNA
Molecular weight formula_weight	60186.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2A

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 36 Entity 36 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	28456.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2B

MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Entity 37 Entity 37 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	25524.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2C

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Entity 38 Entity 38 polymer

Description description	Splicing factor 3A subunit 1
Molecular weight formula_weight	88991.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2D

MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK

Entity 39 Entity 39 polymer

Description description	Splicing factor 3A subunit 2
Molecular weight formula_weight	49327.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2E

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

Entity 40 Entity 40 polymer

Description description	Splicing factor 3A subunit 3
Molecular weight formula_weight	58934.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2F

METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGLL

Entity 41 Entity 41 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146024.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2G

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 42 Entity 42 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2H

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 43 Entity 43 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2I

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 44 Entity 44 polymer

Description description	Splicing factor 3B subunit 4
Molecular weight formula_weight	44436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2J

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

Entity 45 Entity 45 polymer

Description description	Splicing factor 3B subunit 6
Molecular weight formula_weight	14606.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2K

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Entity 46 Entity 46 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	12427.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2L

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Entity 47 Entity 47 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2M

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 48 Entity 48 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 49 Entity 49 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 50 Entity 50 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 51 Entity 51 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	140426

Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

U6 snRNA-associated Sm-like protein LSm2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

116 kDa U5 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 200 kDa helicase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer