7vdv

The overall structure of human chromatin remodeling PBAF-nucleosome complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H4

Xenopus laevis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–103； UniProt 1–103 Author chain F； PDBConstruct 1–103； UniProt 1–103

Histone H2A

Xenopus laevis

UniProt Q6AZJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6AZJ8_XENLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–130； UniProt 1–130 Author chain G； PDBConstruct 1–130； UniProt 1–130

Histone H2B 1.1

Xenopus laevis

UniProt P02281

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B11_XENLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–126； UniProt 1–126 Author chain H； PDBConstruct 1–126； UniProt 1–126

Histone H3

Xenopus laevis

UniProt A0A310TTQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A310TTQ1_XENLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–136； UniProt 1–136 Author chain K； PDBConstruct 1–136； UniProt 1–136

Isoform 2 of Transcription activator BRG1

Homo sapiens

UniProt P51532

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMCA4_HUMAN
Isoform	P51532-2
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 2–1456； UniProt 160–1614

Actin-like protein 6A

Homo sapiens

UniProt O96019

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACL6A_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain N； PDBConstruct 1–429； UniProt 1–429

Actin, cytoplasmic 1

Homo sapiens

UniProt P60709

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain P； PDBConstruct 1–375； UniProt 1–375

AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2

Homo sapiens

UniProt Q68CP9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARID2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Q； PDBConstruct 1–626； UniProt 1–626 Author chain Q； PDBConstruct 627–870； UniProt 1592–1835

PHD finger protein 10

Homo sapiens

UniProt Q8WUB8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF10_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain R； PDBConstruct 17–514； UniProt 1–498

Isoform 2 of Bromodomain-containing protein 7

Homo sapiens

UniProt Q9NPI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BRD7_HUMAN
Isoform	Q9NPI1-2
PDB entities	12
Chains and sequence ranges	Author chain T； PDBConstruct 1–652； UniProt 1–652

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1

Homo sapiens

UniProt Q12824

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNF5_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain V； PDBConstruct 1–385； UniProt 1–385

SWI/SNF complex subunit SMARCC2

Homo sapiens

UniProt Q8TAQ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMRC2_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain W； PDBConstruct 1–1214； UniProt 1–1214 Author chain X； PDBConstruct 1–1214； UniProt 1–1214

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1

Homo sapiens

UniProt Q96GM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMRD1_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Y； PDBConstruct 1–515； UniProt 1–515

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1

Homo sapiens

UniProt Q969G3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） Protein polybromo-1 × 1 （Q86U86） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMCE1_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain Z； PDBConstruct 1–411； UniProt 1–411

Protein polybromo-1

Homo sapiens

UniProt Q86U86

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） Histone H3 × 2 （A0A310TTQ1） DNA (207-MER) × 1 DNA (207-MER) × 1 Isoform 2 of Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2 × 1 （Q68CP9） PHD finger protein 10 × 1 （Q8WUB8） Isoform 2 of Bromodomain-containing protein 7 × 1 （Q9NPI1） unknown × 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） unknown × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PB1_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain a； PDBConstruct 2–1020； UniProt 631–1689

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7vdv
Deposition date deposition_date	2021-09-07
Structure title title	The overall structure of human chromatin remodeling PBAF-nucleosome complex
Keywords keywords	complex, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7vdv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7vdv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7vdv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	69.53 Å
Rg (electron density)	69.61 Å
Total Rg	69.73 Å
Atom count	40009
Residues	4548
Excluded volume	695440 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7vdv__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (22)

Entity 1 Entity 1 polymer

Description description	Histone H4
Molecular weight formula_weight	11394.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F
Atom count atom_count	40028

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Histone H2A
Molecular weight formula_weight	14109.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Histone H2B 1.1
Molecular weight formula_weight	13965.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Histone H3
Molecular weight formula_weight	15435.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,K

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	DNA (207-MER)
Molecular weight formula_weight	63679.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	I

GGACCCTATACGCGGCCGCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGAAGCTTGTCGAGAAGTACTAGAGGATCATAATCAGCCATAC

Entity 6 Entity 6 polymer

Description description	DNA (207-MER)
Molecular weight formula_weight	64145.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	J

GTATGGCTGATTATGATCCTCTAGTACTTCTCGACAAGCTTCAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGGCGGCCGCGTATAGGGTCC

Entity 7 Entity 7 polymer

Description description	Isoform 2 of Transcription activator BRG1
Molecular weight formula_weight	169597.9 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEEDASGGSWSHPQFEKWSHPQFEKWSHPQFEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	Actin-like protein 6A
Molecular weight formula_weight	47509.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2
Molecular weight formula_weight	97547.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKPQLPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVCTLLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDIVDDNEVRDLISDRNKSHEGTSGEWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEEGNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSYREIICHLTLPDVLLVISTLEVLYMLTEMGDVACTKIAKVEKSIDMLVCLVSMDIQMFGPDALAAVKLIEHPSSSHQMLSEIRPQAIEQVQTQTHVASAPASRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSVSRAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVKRRAIPLPIQMYYQQQPVSTSVVRVDSNTPMPPSPAVQVQGQPNSSQPSPFSGSSQPGDPMRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRFSFITHLQDKHCSKDALLAGLKQDEPGQAGSQKSSTKQPTVGGTSSTPRAQKAIVNHPSAALMALRRGSRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVLAISNMEASSTLAKCLYELNFTVQSKEQEKDSEMLQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 11 Entity 11 polymer

Description description	PHD finger protein 10
Molecular weight formula_weight	58254.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MHHHHHHHHHHHHGEFMAAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETSSQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	Isoform 2 of Bromodomain-containing protein 7
Molecular weight formula_weight	74385.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKDMLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPIVGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFANISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHTRTLDTAKEMEQITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	unknown
Molecular weight formula_weight	613.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

XXXXXXX

Source Source

Source organism organism	unidentified
NCBI taxonomy ID ncbi_taxonomy_id	32644
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Molecular weight formula_weight	44199.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 15 Entity 15 polymer

Description description	SWI/SNF complex subunit SMARCC2
Molecular weight formula_weight	133048.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,X

MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHHHHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 16 Entity 16 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
Molecular weight formula_weight	60127.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNTASHHHHHHHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 17 Entity 17 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Molecular weight formula_weight	46710.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 18 Entity 18 polymer

Description description	Protein polybromo-1
Molecular weight formula_weight	116762.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMFEVLERARRMNRTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHNDVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRYSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAYFYGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEERAAKVAEQQERERAGMMGGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIRQAYNLENV

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 19 Entity 19 polymer

Description description	unknown
Molecular weight formula_weight	1379.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

XXXXXXXXXXXXXXXX

Source Source

Source organism organism	unidentified
NCBI taxonomy ID ncbi_taxonomy_id	32644
Host organism host_organism	Homo sapiens

Entity 20 Entity 20 non-polymer

Description description	BERYLLIUM TRIFLUORIDE ION
Molecular weight formula_weight	66.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	137659

The overall structure of human chromatin remodeling PBAF-nucleosome complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B 1.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Isoform 2 of Transcription activator BRG1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-like protein 6A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AT-rich interactive domain-containing protein 2,AT-rich interactive domain-containing protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PHD finger protein 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Isoform 2 of Bromodomain-containing protein 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer