8wlt

Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGH_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–232； UniProt 1–232 Author chain B； PDBConstruct 1–232； UniProt 1–232 Author chain C； PDBConstruct 1–232； UniProt 1–232 Author chain D； PDBConstruct 1–232； UniProt 1–232 Author chain E； PDBConstruct 1–232； UniProt 1–232 Author chain F； PDBConstruct 1–232； UniProt 1–232 Author chain G； PDBConstruct 1–232； UniProt 1–232 Author chain H； PDBConstruct 1–232； UniProt 1–232 Author chain I； PDBConstruct 1–232； UniProt 1–232 Author chain J； PDBConstruct 1–232； UniProt 1–232 Author chain K； PDBConstruct 1–232； UniProt 1–232 Author chain L； PDBConstruct 1–232； UniProt 1–232 Author chain M； PDBConstruct 1–232； UniProt 1–232 Author chain N； PDBConstruct 1–232； UniProt 1–232 Author chain O； PDBConstruct 1–232； UniProt 1–232 Author chain P； PDBConstruct 1–232； UniProt 1–232 Author chain Q； PDBConstruct 1–232； UniProt 1–232 Author chain R； PDBConstruct 1–232； UniProt 1–232 Author chain S； PDBConstruct 1–232； UniProt 1–232 Author chain T； PDBConstruct 1–232； UniProt 1–232 Author chain U； PDBConstruct 1–232； UniProt 1–232 Author chain V； PDBConstruct 1–232； UniProt 1–232 Author chain W； PDBConstruct 1–232； UniProt 1–232 Author chain X； PDBConstruct 1–232； UniProt 1–232 Author chain Y； PDBConstruct 1–232； UniProt 1–232 Author chain Z； PDBConstruct 1–232； UniProt 1–232

Flagellar P-ring protein

OrganismNot specified

UniProt P15930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGI_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–365； UniProt 1–365 Author chain b； PDBConstruct 1–365； UniProt 1–365 Author chain c； PDBConstruct 1–365； UniProt 1–365 Author chain d； PDBConstruct 1–365； UniProt 1–365 Author chain e； PDBConstruct 1–365； UniProt 1–365 Author chain f； PDBConstruct 1–365； UniProt 1–365 Author chain g； PDBConstruct 1–365； UniProt 1–365 Author chain h； PDBConstruct 1–365； UniProt 1–365 Author chain i； PDBConstruct 1–365； UniProt 1–365 Author chain j； PDBConstruct 1–365； UniProt 1–365 Author chain k； PDBConstruct 1–365； UniProt 1–365 Author chain l； PDBConstruct 1–365； UniProt 1–365 Author chain m； PDBConstruct 1–365； UniProt 1–365 Author chain n； PDBConstruct 1–365； UniProt 1–365 Author chain o； PDBConstruct 1–365； UniProt 1–365 Author chain p； PDBConstruct 1–365； UniProt 1–365 Author chain q； PDBConstruct 1–365； UniProt 1–365 Author chain r； PDBConstruct 1–365； UniProt 1–365 Author chain s； PDBConstruct 1–365； UniProt 1–365 Author chain t； PDBConstruct 1–365； UniProt 1–365 Author chain u； PDBConstruct 1–365； UniProt 1–365 Author chain v； PDBConstruct 1–365； UniProt 1–365 Author chain w； PDBConstruct 1–365； UniProt 1–365 Author chain x； PDBConstruct 1–365； UniProt 1–365 Author chain y； PDBConstruct 1–365； UniProt 1–365 Author chain z； PDBConstruct 1–365； UniProt 1–365

Flagellar basal-body rod protein FlgG

OrganismNot specified

UniProt P0A1J3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGG_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 0； PDBConstruct 1–260； UniProt 1–260 Author chain 1； PDBConstruct 1–260； UniProt 1–260 Author chain 2； PDBConstruct 1–260； UniProt 1–260 Author chain 3； PDBConstruct 1–260； UniProt 1–260 Author chain 4； PDBConstruct 1–260； UniProt 1–260 Author chain 5； PDBConstruct 1–260； UniProt 1–260 Author chain 6； PDBConstruct 1–260； UniProt 1–260 Author chain 7； PDBConstruct 1–260； UniProt 1–260 Author chain 8； PDBConstruct 1–260； UniProt 1–260 Author chain 9； PDBConstruct 1–260； UniProt 1–260 Author chain AF； PDBConstruct 1–260； UniProt 1–260 Author chain AG； PDBConstruct 1–260； UniProt 1–260 Author chain AH； PDBConstruct 1–260； UniProt 1–260 Author chain AI； PDBConstruct 1–260； UniProt 1–260 Author chain AJ； PDBConstruct 1–260； UniProt 1–260 Author chain AK； PDBConstruct 1–260； UniProt 1–260 Author chain AL； PDBConstruct 1–260； UniProt 1–260 Author chain AM； PDBConstruct 1–260； UniProt 1–260 Author chain AN； PDBConstruct 1–260； UniProt 1–260 Author chain ZA； PDBConstruct 1–260； UniProt 1–260 Author chain ZB； PDBConstruct 1–260； UniProt 1–260 Author chain ZC； PDBConstruct 1–260； UniProt 1–260 Author chain ZD； PDBConstruct 1–260； UniProt 1–260 Author chain ZE； PDBConstruct 1–260； UniProt 1–260

Flagellar hook protein FlgE

OrganismNot specified

UniProt P0A1J1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGE_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain ZF； PDBConstruct 1–403； UniProt 1–403 Author chain ZG； PDBConstruct 1–403； UniProt 1–403 Author chain ZH； PDBConstruct 1–403； UniProt 1–403 Author chain ZI； PDBConstruct 1–403； UniProt 1–403 Author chain ZJ； PDBConstruct 1–403； UniProt 1–403 Author chain ZK； PDBConstruct 1–403； UniProt 1–403 Author chain ZL； PDBConstruct 1–403； UniProt 1–403 Author chain ZM； PDBConstruct 1–403； UniProt 1–403 Author chain ZN； PDBConstruct 1–403； UniProt 1–403 Author chain ZO； PDBConstruct 1–403； UniProt 1–403 Author chain ZP； PDBConstruct 1–403； UniProt 1–403 Author chain ZQ； PDBConstruct 1–403； UniProt 1–403 Author chain ZR； PDBConstruct 1–403； UniProt 1–403 Author chain ZS； PDBConstruct 1–403； UniProt 1–403 Author chain ZT； PDBConstruct 1–403； UniProt 1–403 Author chain ZU； PDBConstruct 1–403； UniProt 1–403 Author chain ZV； PDBConstruct 1–403； UniProt 1–403 Author chain ZW； PDBConstruct 1–403； UniProt 1–403 Author chain ZX； PDBConstruct 1–403； UniProt 1–403 Author chain ZY； PDBConstruct 1–403； UniProt 1–403 Author chain ZZ； PDBConstruct 1–403； UniProt 1–403 Author chain Za； PDBConstruct 1–403； UniProt 1–403 Author chain Zb； PDBConstruct 1–403； UniProt 1–403 Author chain Zc； PDBConstruct 1–403； UniProt 1–403 Author chain Zd； PDBConstruct 1–403； UniProt 1–403 Author chain Ze； PDBConstruct 1–403； UniProt 1–403 Author chain Zf； PDBConstruct 1–403； UniProt 1–403 Author chain Zg； PDBConstruct 1–403； UniProt 1–403 Author chain Zh； PDBConstruct 1–403； UniProt 1–403

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt P16323

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGF_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AA； PDBConstruct 1–251； UniProt 1–251 Author chain AB； PDBConstruct 1–251； UniProt 1–251 Author chain AC； PDBConstruct 1–251； UniProt 1–251 Author chain AD； PDBConstruct 1–251； UniProt 1–251 Author chain AE； PDBConstruct 1–251； UniProt 1–251

Flagellar M-ring protein

OrganismNot specified

UniProt P15928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AO； PDBConstruct 1–560； UniProt 1–560 Author chain AP； PDBConstruct 1–560； UniProt 1–560 Author chain AQ； PDBConstruct 1–560； UniProt 1–560 Author chain AR； PDBConstruct 1–560； UniProt 1–560 Author chain AS； PDBConstruct 1–560； UniProt 1–560 Author chain AT； PDBConstruct 1–560； UniProt 1–560 Author chain AU； PDBConstruct 1–560； UniProt 1–560 Author chain AV； PDBConstruct 1–560； UniProt 1–560 Author chain AW； PDBConstruct 1–560； UniProt 1–560 Author chain AX； PDBConstruct 1–560； UniProt 1–560 Author chain AY； PDBConstruct 1–560； UniProt 1–560 Author chain AZ； PDBConstruct 1–560； UniProt 1–560 Author chain Aa； PDBConstruct 1–560； UniProt 1–560 Author chain Ac； PDBConstruct 1–560； UniProt 1–560 Author chain Ad； PDBConstruct 1–560； UniProt 1–560 Author chain Ae； PDBConstruct 1–560； UniProt 1–560 Author chain Af； PDBConstruct 1–560； UniProt 1–560 Author chain Ag； PDBConstruct 1–560； UniProt 1–560 Author chain Ah； PDBConstruct 1–560； UniProt 1–560 Author chain Ai； PDBConstruct 1–560； UniProt 1–560 Author chain Aj； PDBConstruct 1–560； UniProt 1–560 Author chain Ak； PDBConstruct 1–560； UniProt 1–560 Author chain Al； PDBConstruct 1–560； UniProt 1–560 Author chain Am； PDBConstruct 1–560； UniProt 1–560 Author chain An； PDBConstruct 1–560； UniProt 1–560 Author chain Ao； PDBConstruct 1–560； UniProt 1–560 Author chain Ap； PDBConstruct 1–560； UniProt 1–560 Author chain BG； PDBConstruct 1–560； UniProt 1–560 Author chain BH； PDBConstruct 1–560； UniProt 1–560 Author chain BI； PDBConstruct 1–560； UniProt 1–560 Author chain BJ； PDBConstruct 1–560； UniProt 1–560 Author chain BK； PDBConstruct 1–560； UniProt 1–560 Author chain BL； PDBConstruct 1–560； UniProt 1–560 Author chain BM； PDBConstruct 1–560； UniProt 1–560 Author chain BN； PDBConstruct 1–560； UniProt 1–560 Author chain BO； PDBConstruct 1–560； UniProt 1–560 Author chain BP； PDBConstruct 1–560； UniProt 1–560 Author chain BQ； PDBConstruct 1–560； UniProt 1–560 Author chain BR； PDBConstruct 1–560； UniProt 1–560 Author chain BS； PDBConstruct 1–560； UniProt 1–560 Author chain BT； PDBConstruct 1–560； UniProt 1–560 Author chain BU； PDBConstruct 1–560； UniProt 1–560 Author chain BV； PDBConstruct 1–560； UniProt 1–560 Author chain BW； PDBConstruct 1–560； UniProt 1–560 Author chain BX； PDBConstruct 1–560； UniProt 1–560 Author chain UI； PDBConstruct 1–560； UniProt 1–560 Author chain UJ； PDBConstruct 1–560； UniProt 1–560 Author chain UK； PDBConstruct 1–560； UniProt 1–560 Author chain UL； PDBConstruct 1–560； UniProt 1–560 Author chain UM； PDBConstruct 1–560； UniProt 1–560 Author chain UN； PDBConstruct 1–560； UniProt 1–560 Author chain UO； PDBConstruct 1–560； UniProt 1–560 Author chain UP； PDBConstruct 1–560； UniProt 1–560 Author chain WA； PDBConstruct 1–560； UniProt 1–560 Author chain WB； PDBConstruct 1–560； UniProt 1–560 Author chain WC； PDBConstruct 1–560； UniProt 1–560 Author chain WD； PDBConstruct 1–560； UniProt 1–560 Author chain WE； PDBConstruct 1–560； UniProt 1–560 Author chain WF； PDBConstruct 1–560； UniProt 1–560 Author chain WG； PDBConstruct 1–560； UniProt 1–560 Author chain WH； PDBConstruct 1–560； UniProt 1–560 Author chain WI； PDBConstruct 1–560； UniProt 1–560 Author chain WJ； PDBConstruct 1–560； UniProt 1–560 Author chain WK； PDBConstruct 1–560； UniProt 1–560 Author chain WL； PDBConstruct 1–560； UniProt 1–560 Author chain WM； PDBConstruct 1–560； UniProt 1–560 Author chain WN； PDBConstruct 1–560； UniProt 1–560 Author chain WO； PDBConstruct 1–560； UniProt 1–560 Author chain WP； PDBConstruct 1–560； UniProt 1–560 Author chain WQ； PDBConstruct 1–560； UniProt 1–560 Author chain WR； PDBConstruct 1–560； UniProt 1–560 Author chain WS； PDBConstruct 1–560； UniProt 1–560 Author chain WT； PDBConstruct 1–560； UniProt 1–560 Author chain WU； PDBConstruct 1–560； UniProt 1–560 Author chain WV； PDBConstruct 1–560； UniProt 1–560 Author chain WW； PDBConstruct 1–560； UniProt 1–560

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt P0A1L5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIQ_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–89； UniProt 1–89 Author chain Aq； PDBConstruct 1–89； UniProt 1–89 Author chain Ar； PDBConstruct 1–89； UniProt 1–89 Author chain As； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt P54702

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain At； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt P54700

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIP_SALTY
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Au； PDBConstruct 1–245； UniProt 1–245 Author chain Av； PDBConstruct 1–245； UniProt 1–245 Author chain Aw； PDBConstruct 1–245； UniProt 1–245 Author chain Ax； PDBConstruct 1–245； UniProt 1–245 Author chain Ay； PDBConstruct 1–245； UniProt 1–245

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt P26462

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A1； PDBConstruct 1–104； UniProt 1–104 Author chain A2； PDBConstruct 1–104； UniProt 1–104 Author chain A3； PDBConstruct 1–104； UniProt 1–104 Author chain A4； PDBConstruct 1–104； UniProt 1–104 Author chain A5； PDBConstruct 1–104； UniProt 1–104 Author chain Az； PDBConstruct 1–104； UniProt 1–104

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain A0； PDBConstruct 1–138； UniProt 1–138 Author chain A6； PDBConstruct 1–138； UniProt 1–138 Author chain A7； PDBConstruct 1–138； UniProt 1–138 Author chain A8； PDBConstruct 1–138； UniProt 1–138 Author chain A9； PDBConstruct 1–138； UniProt 1–138

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 213	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain BA； PDBConstruct 1–134； UniProt 1–134 Author chain BB； PDBConstruct 1–134； UniProt 1–134 Author chain BC； PDBConstruct 1–134； UniProt 1–134 Author chain BD； PDBConstruct 1–134； UniProt 1–134 Author chain BE； PDBConstruct 1–134； UniProt 1–134 Author chain BF； PDBConstruct 1–134； UniProt 1–134

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wlt
Deposition date deposition_date	2023-10-01
Structure title title	Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state
Keywords keywords	Flagellar motor, Flagellum, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8wlt__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8wlt__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8wlt__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	134.60 Å
Total Rg	134.30 Å
Atom count	338664
Residues	45376
Excluded volume	5973400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8wlt__assembly_1__model_1`	213-meric （213）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24726.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z
Atom count atom_count	338664

MQKYALHAYPVMALMVATLTGCAWIPAKPLVQGATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

Entity 2 Entity 2 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	38194.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z

MFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRGGTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQFGAGNTINLQLNDEDFTMAQQITDAINRARGYGSATALDARTVQVRVPSGNSSQVRFLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPNTPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQSAGCLRAKLEII

Entity 3 Entity 3 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27784.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,1,2,3,4,5,6,7,8,9,ZA,ZB,ZC,ZD,ZE,AF,AG,AH,AI,AJ,AK,AL,AM,AN

MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL

Entity 4 Entity 4 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	42233.2 kDa
Source method src_method	nat
Copy count entity_count	29

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ZF,ZG,ZH,ZI,ZJ,ZK,ZL,ZM,ZN,ZO,ZP,ZQ,ZR,ZS,ZT,ZU,ZV,ZW,ZX,ZY,ZZ,Za,Zb,Zc,Zd,Ze,Zf,Zg,Zh

MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR

Entity 5 Entity 5 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26121.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE

MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDPPNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSMS

Entity 6 Entity 6 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	76

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;AR,AS,AT,AU,AV,AW,AX,AY,AZ,Aa,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,An,Ao,Ap,AO,AP,AQ,UI,UJ,UK,UL,UM,UN,UO,UP,WA,WB,WC,WD,WE,WF,WG,WH,WI,WJ,WK,WL,WM,WN,WO,WP,WQ,WR,WS,WT,WU,WV,WW,BG,BH,BI,BJ,BK,BL,BM,BN,BO,BP,BQ,BR,BS,BT,BU,BV,BW,BX ;

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 7 Entity 7 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab,Aq,Ar,As

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 8 Entity 8 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	At

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 9 Entity 9 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Au,Av,Aw,Ax,Ay

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 10 Entity 10 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Az,A1,A2,A3,A4,A5

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 11 Entity 11 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A6,A7,A8,A9,A0

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 12 Entity 12 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA,BB,BC,BD,BE,BF

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	11858

Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer