8oe0

Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 2).

Method: ELECTRON MICROSCOPY D_max: 185.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-12 subunit alpha

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 其他Polymer 2 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 23–215	Not recorded	Interleukin-12 subunit beta × 1 （P43432） Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1 × 1 （Q60837,P53355） Interleukin-12 receptor subunit beta-2,Calmodulin-1 × 1 （P97378,P0DP23） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions：Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 4.60 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8OE0	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8CR6 mouse Interleukin-12 Deposited 2023-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–215（215 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；JCSG-plus G4: 0.2 M TMAO, 0.1 M Tris pH 8.5, 20% w/v/ PEG 2000 MME, 20 mM BaCl2	Resolution 2.85 Å R-free 0.296
8ODZ Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1). Deposited 2023-03-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 23–215（193 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.60 Å
8PB1 Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1), obtained after local refinement. Deposited 2023-06-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 23–215（193 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.50 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL12A_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–193； UniProt 23–215

Interleukin-12 subunit beta

Mus musculus

UniProt P43432

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 其他Polymer 2 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 23–335	Not recorded	Interleukin-12 subunit alpha × 1 （P43431） Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1 × 1 （Q60837,P53355） Interleukin-12 receptor subunit beta-2,Calmodulin-1 × 1 （P97378,P0DP23） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions：Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 4.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OE0	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6SFF mouse Interleukin-12 subunit beta - p80 homodimer in space group I41 Deposited 2019-08-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–335（335 aa）	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；287 K；120 mM monosaccharides, 50 mM Imidazole, 50 mM MES, pH6.5, 20% Ethylene glycol, 10 % PEG 8000 (MORPHEUS 1, F2)	Resolution 2.40 Å R-free 0.265
6SMC mouse Interleukin-12 subunit beta - p80 homodimer in space group P1 Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–335（335 aa） Chain C 1–335（335 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；287 K；200 MM NAFORMATE, 100 MM NAPO4 PH 6.2, 10 % GLYCEROL, 20% MEDIUM PEG SMEAR (BCS CONDITION 40)	Resolution 3.50 Å R-free 0.310
6SMC mouse Interleukin-12 subunit beta - p80 homodimer in space group P1 Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 1–335（335 aa） Chain D 1–335（335 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；287 K；200 MM NAFORMATE, 100 MM NAPO4 PH 6.2, 10 % GLYCEROL, 20% MEDIUM PEG SMEAR (BCS CONDITION 40)	Resolution 3.50 Å R-free 0.310
6SP3 mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 1 Deposited 2019-08-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–335（335 aa） Chain B 1–335（335 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；287 K；5% MPD, 10% PEG6000, 100mM HEPES pH7.5 (Crystal screen HT condition 78)	Resolution 3.00 Å R-free 0.267
7PUR mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 2 Deposited 2021-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–335（335 aa） Chain B 1–335（335 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；287 K；5% MPD, 10% PEG6000, 100mM TRIS pH7.5	Resolution 3.90 Å R-free 0.324
7R3N mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 3 Deposited 2022-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–335（335 aa） Chain B 1–335（335 aa）	Not recorded	PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；287 K；BCS screen, 0.2M sodium formate, 0.1M sodium phosphate pH 6.0, 17% PEG Smear Medium, 10% Glycerol. Cryoprotected with up to 27.5% PEG Smear Medium prior to vitrification.	Resolution 3.16 Å R-free 0.258
7R3N mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 3 Deposited 2022-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–335（335 aa） Chain D 1–335（335 aa）	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；287 K；BCS screen, 0.2M sodium formate, 0.1M sodium phosphate pH 6.0, 17% PEG Smear Medium, 10% Glycerol. Cryoprotected with up to 27.5% PEG Smear Medium prior to vitrification.	Resolution 3.16 Å R-free 0.258
8CR5 Murine Interleukin-12 receptor beta 1 domain 1 in complex with murine Interleukin-12 beta. Deposited 2023-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–335（335 aa）	Mutation：C197S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；(BCS E4) 20% PEG smear medium, 0.1M MgCl2, 0.1 M KCl, 0.1M PIPES pH 7.0	Resolution 2.15 Å R-free 0.282
8CR6 mouse Interleukin-12 Deposited 2023-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–335（335 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；JCSG-plus G4: 0.2 M TMAO, 0.1 M Tris pH 8.5, 20% w/v/ PEG 2000 MME, 20 mM BaCl2	Resolution 2.85 Å R-free 0.296
8ODZ Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1). Deposited 2023-03-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 23–335（313 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.60 Å
8PB1 Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1), obtained after local refinement. Deposited 2023-06-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 23–335（313 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.50 Å

9 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL12B_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–313； UniProt 23–335

Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1

Mus musculus

UniProt P53355

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 其他Polymer 2 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain C； UniProt 300–319	Not recorded	Interleukin-12 subunit alpha × 1 （P43431） Interleukin-12 subunit beta × 1 （P43432） Interleukin-12 receptor subunit beta-2,Calmodulin-1 × 1 （P97378,P0DP23） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions：Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 4.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OE0	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1IG1 1.8A X-Ray structure of ternary complex of a catalytic domain of death-associated protein kinase with ATP analogue and Mn. Deposited 2001-04-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：CATALYTIC DOMAIN, PROTEIN KINASE DOMAIN	Not recorded	MN MANGANESE (II) ION × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.80 Å R-free 0.213
1JKK 2.4A X-RAY STRUCTURE OF TERNARY COMPLEX OF A CATALYTIC DOMAIN OF DEATH-ASSOCIATED PROTEIN KINASE WITH ATP ANALOGUE AND MG. Deposited 2001-07-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：CATALYTIC DOMAIN, PROTEIN KINASE DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；PROTEIN, AMPPnP, AMMONIUM SULFATE, TRIS-HL (pH 8), MGCL2 SOAKING, pH 7.5	Resolution 2.40 Å R-free 0.239
1JKL 1.6A X-RAY STRUCTURE OF BINARY COMPLEX OF A CATALYTIC DOMAIN OF DEATH-ASSOCIATED PROTEIN KINASE WITH ATP ANALOGUE Deposited 2001-07-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：CATALYTIC DOMAIN, PROTEIN KINASE DOMAIN	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；PROTEIN, AMPPNP, AMMONIUM SULFATE, TRIS-HL, pH 7.5	Resolution 1.62 Å R-free 0.218
1JKS 1.5A X-RAY STRUCTURE OF APO FORM OF A CATALYTIC DOMAIN OF DEATH-ASSOCIATED PROTEIN KINASE Deposited 2001-07-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：CATALYTIC DOMAIN, PROTEIN KINASE DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.50	Resolution 1.50 Å R-free 0.202
1JKT TETRAGONAL CRYSTAL FORM OF A CATALYTIC DOMAIN OF DEATH-ASSOCIATED PROTEIN KINASE Deposited 2001-07-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：CATALYTIC DOMAIN, PROTEIN KINASE DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.00	Resolution 3.50 Å R-free 0.297
1JKT TETRAGONAL CRYSTAL FORM OF A CATALYTIC DOMAIN OF DEATH-ASSOCIATED PROTEIN KINASE Deposited 2001-07-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–285（284 aa） Fragment：CATALYTIC DOMAIN, PROTEIN KINASE DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.00	Resolution 3.50 Å R-free 0.297
1P4F DEATH ASSOCIATED PROTEIN KINASE CATALYTIC DOMAIN WITH BOUND INHIBITOR FRAGMENT Deposited 2003-04-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：CATALYTIC DOMAIN, PROTEIN KINASE DOMAIN	Not recorded	86Q 5,6-Dihydro-benzo[H]cinnolin-3-ylamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；297 K；Ammonium sulfate, Tris, MgCl2, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 1.90 Å R-free 0.233
1WVW Crystal structures of kinase domain of DAP kinase in complex with small molecular inhibitors Deposited 2004-12-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–278（278 aa） Fragment：catalytic domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；283 K；sodium cacodylate, PEG8000, magnesium acetate, glycerol, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 283K	Resolution 2.40 Å R-free 0.270
1WVX Crystal structures of kinase domain of DAP kinase in complex with small molecular inhibitors Deposited 2004-12-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–278（278 aa） Fragment：catalytic domain	Not recorded	BD4 6-(3-AMINOPROPYL)-4,9-DIMETHYLPYRROLO[3,4-C]CARBAZOLE-1,3(2H,6H)-DIONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；283 K；Tris-HCl, PEG400, PEG8000, glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 283K	Resolution 2.60 Å R-free 0.270
1WVY Crystal structures of kinase domain of DAP kinase in complex with small molecular inhibitors Deposited 2004-12-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–278（278 aa） Fragment：catalytic domain	Not recorded	STU STAUROSPORINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；283 K；Tris-HCl, PEG400, PEG8000, glycerol, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 283K	Resolution 2.80 Å R-free 0.274
1YR5 1.7-A structure of calmodulin bound to a peptide from DAP kinase Deposited 2005-02-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 302–320（19 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；PEG 8000, sodium acetate, calcium chloride, pH 4.8, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.70 Å R-free 0.257
2W4J X-ray structure of a DAP-Kinase 2-277 Deposited 2008-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–277（277 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-277	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 ACT ACETATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.30 Å R-free 0.159
2W4K X-ray structure of a DAP-Kinase 2-302 Deposited 2008-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–302（302 aa） Fragment：CATALYTIC AUTOINHIBITORY DOMAIN, RESIDUES 1-302	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å R-free 0.228
2X0G X-RAY STRUCTURE OF A DAP-KINASE CALMODULIN COMPLEX Deposited 2009-12-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–334（334 aa） Fragment：CATALYTIC AND AUTOINHIBITORY DOMAIN, RESIDUES 1- 334	Not recorded	SO4 SULFATE ION × 2 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；0.17M AMMONIUM SULFATE, 25% (W/V) PEG 4000, 15% GLYCEROL, pH 7.2	Resolution 2.20 Å R-free 0.267
2XUU Crystal structure of a DAP-kinase 1 mutant Deposited 2010-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–334（334 aa） Fragment：CATALYTIC AND AUTOINHIBITORY DOMAIN, RESIDUES 1-334	Mutation：YES	ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 3 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；0.2 M LISO4 0.1 M BIS-TRIS PH 5.5 25% PEG 4000 0.002% NAN3	Resolution 1.80 Å R-free 0.226
2XZS Death associated protein kinase 1 residues 1-312 Deposited 2010-11-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–312（311 aa） Fragment：KINASE CATALYTIC DOMAIN, RESIDUES 1-312	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.2 M MAGNESIUM ACETATE TETRAHYDRATE, 0.1 M SODIUM CACODYLATE, PH 6.5 AND 10% PEG 8000	Resolution 2.00 Å R-free 0.225
2XZS Death associated protein kinase 1 residues 1-312 Deposited 2010-11-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–312（311 aa） Fragment：KINASE CATALYTIC DOMAIN, RESIDUES 1-312	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.2 M MAGNESIUM ACETATE TETRAHYDRATE, 0.1 M SODIUM CACODYLATE, PH 6.5 AND 10% PEG 8000	Resolution 2.00 Å R-free 0.225
2Y0A Structure of DAPK1 construct residues 1-304 Deposited 2010-12-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–304（303 aa） Fragment：KINASE CATALYTIC DOMAIN, RESIDUES 2-304	Not recorded	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；5% PEG 6000, 0.1M MES, PH 6.0	Resolution 2.60 Å R-free 0.259
2Y4P Dimeric structure of DAPK-1 catalytic domain Deposited 2011-01-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–285（285 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-285 Chain D 1–285（285 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-285	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；0.1 M TRIS PH 8.0, 0.1 M MGCL2, 15% (W/V) PEG 4000, 0.5 MM AMPPCP, 0.5 MM PMSF.	Resolution 2.65 Å R-free 0.312
2Y4P Dimeric structure of DAPK-1 catalytic domain Deposited 2011-01-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–285（285 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-285 Chain B 1–285（285 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-285	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；0.1 M TRIS PH 8.0, 0.1 M MGCL2, 15% (W/V) PEG 4000, 0.5 MM AMPPCP, 0.5 MM PMSF.	Resolution 2.65 Å R-free 0.312
2Y4V CRYSTAL STRUCTURE OF HUMAN CALMODULIN IN COMPLEX WITH A DAP KINASE-1 MUTANT (W305Y) PEPTIDE Deposited 2011-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 302–320（19 aa） Fragment：RESIDUES 302-320	Mutation：YES	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M HEPES PH 7.5, 25(W/V) PEG 3000	Resolution 1.80 Å R-free 0.238
2YAK Structure of death-associated protein Kinase 1 (dapk1) in complex with a ruthenium octasporine ligand (OSV) Deposited 2011-02-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：AA, RESIDUES 1-285	Not recorded	OSV RUTHENIUM OCTASPORINE 4 × 1	X-RAY DIFFRACTION X-ray crystallization conditions 100 MM TRIS PH 7.2, 7.5-10% PEG 6000.	Resolution 2.20 Å R-free 0.260
3DFC Crystal structure of a glycine-rich loop mutant of the death associated protein kinase catalytic domain with AMPPNP Deposited 2008-06-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–285（285 aa） Fragment：Protein kinase catalytic domain	Mutation：Q23K	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.2M lithium nitrate, 2.2 M ammonium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.90 Å R-free 0.230
3DGK Crystal structure of a glycine-rich loop mutant of the death associated protein kinase catalytic domain Deposited 2008-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：Protein kinase catalytic domain	Mutation：Q23K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；295 K；100 mM Tris pH 7.5, 0.8 M Ammonium Sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.70 Å R-free 0.220
3EH9 Crystal structure of death associated protein kinase complexed with ADP Deposited 2008-09-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：Protein kinase domain, UNP residues 2-285	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；.2 M ammonium iodide 2.2 M ammonium sulfate , VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.70 Å R-free 0.217
3EHA Crystal structure of death associated protein kinase complexed with AMPPNP Deposited 2008-09-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：Protein kinase domain, UNP residues 2-285	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.2 M ammonium bromide 2.2 M ammonium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.60 Å R-free 0.210
3F5G Crystal structure of death associated protein kinase in complex with ADP and Mg2+ Deposited 2008-11-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：UNP residues 2-285, protein kinase domain,catalytic domain	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 295 K；0.2 M ammonium chloride, 2.2 M ammonium sulfate , VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.85 Å R-free 0.244
3F5U Crystal structure of the death associated protein kinase in complex with AMPPNP and Mg2+ Deposited 2008-11-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP residues 1-285, Protein kinase domain,Catalytic domain	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 295 K；0.2 M NaCl, 2.2 M ammonium sulfate , VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.00 Å R-free 0.245
3GU4 Crystal structure of DAPKQ23V-AMPPNP Deposited 2009-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：protein kinase domain	Mutation：Q23V	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295 K；0.1 M MES, 1.8 M Ammonium sulfate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.35 Å R-free 0.211
3GU5 Crystal structure of DAPKQ23V-AMPPNP-Mg2+ Deposited 2009-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：protein kinase domain	Mutation：Q23V	MG MAGNESIUM ION × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.2M CH3COOLi, 2.2 Ammonium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.65 Å R-free 0.219
3GU6 Crystal structure of DAPKQ23V-ADP Deposited 2009-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：protein kinase domain	Mutation：Q23V	ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1 M Tris, 1.8 M Ammonium sulfate, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.49 Å R-free 0.213
3GU7 Crystal structure of DAPKQ23V-ADP-Mg2+ Deposited 2009-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：protein kinase domain	Mutation：Q23V	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.2M NaI, 2.2M ammonium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.90 Å R-free 0.228
3GU8 Crystal structure of DAPKL93G with N6-cyclopentyladenosine Deposited 2009-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：protein kinase domain	Mutation：L93G	3GU N6-cyclopentyladenosine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；295 K；100 mM Tris, 1.1 ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.60 Å R-free 0.239
3GUB Crystal structure of DAPKL93G complexed with N6-(2-Phenylethyl)adenosine Deposited 2009-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：protein kinase domain	Mutation：L93G	GUB 9-alpha-L-lyxofuranosyl-N-(2-phenylethyl)-9H-purin-6-amine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；295 K；100mM Tris, 1.1 M ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.71 Å R-free 0.239
3ZXT Dimeric structure of DAPK-1 catalytic domain in complex with AMPPCP- Mg Deposited 2011-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–285（285 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-285 Chain B 1–285（285 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-285	Not recorded	ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 2 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions 0.1 M HEPES PH7.0, 0.1M MGCL2, 15% PEG4000	Resolution 2.65 Å R-free 0.285
3ZXT Dimeric structure of DAPK-1 catalytic domain in complex with AMPPCP- Mg Deposited 2011-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–285（285 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-285 Chain D 1–285（285 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-285	Not recorded	ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions 0.1 M HEPES PH7.0, 0.1M MGCL2, 15% PEG4000	Resolution 2.65 Å R-free 0.285
4B4L CRYSTAL STRUCTURE OF AN ARD DAP-KINASE 1 MUTANT Deposited 2012-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–334（334 aa） Fragment：CATALYTIC AND AUTOREGULATORY DOMAIN, RESIDUES 1-334	Mutation：YES	1PE PENTAETHYLENE GLYCOL × 3 SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；0.2M AMMONIUM SULFATE, 0.1M BIS-TRIS PH 5.5, 25%(W/V) POLYETHYLENE GLYCOL 3350	Resolution 1.75 Å R-free 0.220
4PF4 1.1A X-RAY STRUCTURE OF THE APO CATALYTIC DOMAIN OF DEATH-ASSOCIATED PROTEIN KINASE 1, aa 1-277 Deposited 2014-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: Monomeric	Chain A 1–277（277 aa）	Not recorded	SO4 SULFATE ION × 4 NA SODIUM ION × 2 GOL GLYCEROL × 6 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；292 K；0.1 M HEPES, Ph=7, 2M Ammonium sulfate	Resolution 1.13 Å R-free 0.149
4TL0 Crystal structure of death-associated protein kinase 1 with a crucial phosphomimicking mutation Deposited 2014-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–334（334 aa） Fragment：UNP residues 1-334	Mutation：S289E	MG MAGNESIUM ION × 1 NH4 AMMONIUM ION × 3 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；292 K；0.15 ammonium sulfate, 0.1M TRIS, pH 8.0, 15%(w/v) PEG 4000	Resolution 2.70 Å R-free 0.218
4TXC Crystal Structure of DAPK1 kinase domain in complex with a small molecule inhibitor Deposited 2014-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	38G 4-(3-{3-[(R)-{[2-(dimethylamino)ethyl]amino}(hydroxy)methyl]phenyl}imidazo[1,2-b]pyridazin-6-yl)-2-methoxyphenol × 1 EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；20% PEG6000, 10% ethylene glycol, 0.1M HEPES pH 7.0, 0.2M sodium chloride, 293K, using previously frozen protein	Resolution 1.95 Å R-free 0.216
4UV0 Structure of a semisynthetic phosphorylated DAPK Deposited 2014-08-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–321（321 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 1-321	Mutation：YES	PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions 5MM HEPES, 30 MM NACL, 10 MM NA2SO4,0.5 MMDTT,25% (W/V) PEGMME2000	Resolution 2.49 Å R-free 0.242
4YO4 Crystal Structure of DAPK1 catalytic domain in complex with the hinge binding fragment phthalazine Deposited 2015-03-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：protein kinase domain (UNP residues 2-285)	Not recorded	CL CHLORIDE ION × 4 ACT ACETATE ION × 1 SO4 SULFATE ION × 1 4FT phthalazine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.2 M sodium chloride, 0.1 M HEPES, 1.6 M ammonium sulfate	Resolution 1.60 Å R-free 0.185
4YPD Crystal Structure of DAPK1 catalytic domain in complex with the hinge binding fragment 4-methylpyridazine Deposited 2015-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：protein kinase domain (UNP residues 2-285)	Not recorded	CL CHLORIDE ION × 1 SO4 SULFATE ION × 1 DKG 4-methylpyridazine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；0.1 M HEPES, 1.7 M ammonium sulfate	Resolution 1.40 Å R-free 0.177
5AUT Crystal structure of DAPK1 in complex with ANS. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	2AN 8-ANILINO-1-NAPHTHALENE SULFONATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.70 Å R-free 0.202
5AUU Crystal structure of DAPK1 in complex with luteolin. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	LU2 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.70 Å R-free 0.216
5AUV Crystal structure of DAPK1 in complex with apigenin. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	AGI 5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.50 Å R-free 0.194
5AUW Crystal structure of DAPK1 in complex with quercetin. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	QUE 3,5,7,3',4'-PENTAHYDROXYFLAVONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.50 Å R-free 0.211
5AUX Crystal structure of DAPK1 in complex with kaempferol. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	KMP 3,5,7-TRIHYDROXY-2-(4-HYDROXYPHENYL)-4H-CHROMEN-4-ONE × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.50 Å R-free 0.208
5AUY Crystal structure of DAPK1 in complex with morin. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	MRI 2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 2.00 Å R-free 0.249
5AUZ Crystal structure of DAPK1 in complex with genistein. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	GEN GENISTEIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.60 Å R-free 0.206
5AV0 Crystal structure of DAPK1 in complex with 7,3',4'-trihydroxyisoflavone. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	47X 3-(3,4-dihydroxyphenyl)-7-hydroxy-4H-chromen-4-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.85 Å R-free 0.220
5AV1 Crystal structure of DAPK1 in the presence of bromide ions. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	BR BROMIDE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.50 Å R-free 0.215
5AV2 Crystal structure of DAPK1-kaempferol complex in the presence of bromide ions. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	KMP 3,5,7-TRIHYDROXY-2-(4-HYDROXYPHENYL)-4H-CHROMEN-4-ONE × 1 BR BROMIDE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.50 Å R-free 0.209
5AV3 Crystal structure of DAPK1-kaempferol complex in the presence of iodide ions. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	KMP 3,5,7-TRIHYDROXY-2-(4-HYDROXYPHENYL)-4H-CHROMEN-4-ONE × 1 IOD IODIDE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.90 Å R-free 0.233
5AV4 Crystal structure of DAPK1-genistein complex in the presence of bromide ions. Deposited 2015-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa） Fragment：UNP RESIDUES 1-285	Not recorded	GEN GENISTEIN × 1 BR BROMIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M ammonium sulfate, 0.1 M MES	Resolution 1.40 Å R-free 0.228
6AAR Crystal structure of DAPK1 in complex with purpurin Deposited 2018-07-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	9TF Purpurin × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.6 M ammonium sulfate, 0.1 M MES pH 6.5	Resolution 1.95 Å R-free 0.220
6FHA Death-associated Protein Kinase 1 (DAPK1) catalytic and auto-regulatory domains with S289A and S308A mutations Deposited 2018-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–334（333 aa）	Mutation：S289A S308A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292.15 K；22% PEG 4000, 0.2M ammonium sulfate, 0.1M sodium sulfate	Resolution 2.30 Å R-free 0.267
6FHB Death-associated Protein Kinase 1 (DAPK1) catalytic and auto-regulatory domains with S289A and S308E mutations Deposited 2018-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–334（333 aa）	Mutation：S289A S308E	CL CHLORIDE ION × 5 ACT ACETATE ION × 1 MG MAGNESIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292.15 K；10% PEG 8000, 0.2M magnesium acetate	Resolution 1.75 Å R-free 0.222
6IN4 Crystal structure of apo DAPK1 in the presence of 18-crown-6 Deposited 2018-10-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.8 M ammonium sulfate, 0.1 M MES pH 6.5, 100 mM 18-crown-6	Resolution 1.80 Å R-free 0.218
6QMO Death-associated Protein Kinase 1 (DAPK1) catalytic and auto-regulatory domains with S289E and S308A mutations Deposited 2019-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–310（309 aa）	Mutation：S289E S308A	GOL GLYCEROL × 6 CL CHLORIDE ION × 5 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292.15 K；20% PEG 3350, 0.2M magnesium formate	Resolution 1.87 Å R-free 0.224
6QN4 Death-associated Protein Kinase 1 (DAPK1) catalytic and auto-regulatory domains with S289E and S308E mutations Deposited 2019-02-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–310（309 aa）	Mutation：S289E S308E	ACT ACETATE ION × 7 GOL GLYCEROL × 4 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292.15 K；16% PEG 4000, 0.1 M Tris pH 8.5, 0.2 M sodium acetate	Resolution 2.50 Å R-free 0.266
7CCU Crystal structure of death-associated protein kinase 1 in complex with resveratrol Deposited 2020-06-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	STL RESVERATROL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.4 M ammonium sulfate, 0.1 M Tris-HCl pH 8.0, 14.4 mg/mL DAPK1, 2 mM resveratrol	Resolution 1.65 Å R-free 0.199
7CCV Crystal structure of death-associated protein kinase 1 in complex with piceatannol Deposited 2020-06-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	PIT PICEATANNOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M ammonium sulfate, 0.1 M Tris-HCl pH 7.0, 14.4 mg/mL DAPK1, 2 mM piceatannol	Resolution 1.75 Å R-free 0.208
7CCW Crystal structure of death-associated protein kinase 1 in complex with resveratrol and MES Deposited 2020-06-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	STL RESVERATROL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.8 M ammonium sulfate, 0.1 M MES-NaOH pH 6.5, 14.4 mg/mL DAPK1, 2 mM resveratrol	Resolution 1.40 Å R-free 0.188
8IE5 Crystal structure of DAPK1 in complex with oxyresveratrol Deposited 2023-02-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	EZE trans-oxyresveratrol × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 400, ammonium sulfate, Bis-tris pH 6.5	Resolution 1.80 Å R-free 0.210
8IE6 Crystal structure of DAPK1 in complex with pinostilbene Deposited 2023-02-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	8KZ 3-[(E)-2-(4-hydroxyphenyl)ethenyl]-5-methoxy-phenol × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 400, ammonium sulfate, Bis-tris pH 6.5	Resolution 1.70 Å R-free 0.195
8IE7 Crystal structure of DAPK1 in complex with pterostilbene Deposited 2023-02-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	3RL Pterostilbene × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG400, ammonium sulfate, Bis-tris pH 6.5	Resolution 1.85 Å R-free 0.211
8IE8 Crystal structure of DAPK1 in complex with isorhapontigenin Deposited 2023-02-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	P5O 5-[(~{E})-2-(3-methoxy-4-oxidanyl-phenyl)ethenyl]benzene-1,3-diol × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG400, ammonium sulfate, Bis-tris pH 6.5	Resolution 1.75 Å R-free 0.216
8ODZ Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1). Deposited 2023-03-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 300–319（20 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.60 Å
8OE4 Cryo-EM structure of a pre-dimerized human IL-23 complete extracellular signaling complex. Deposited 2023-03-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 301–319（19 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 4.5 s. blotting time.	Resolution 3.60 Å
8PB1 Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1), obtained after local refinement. Deposited 2023-06-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 300–319（20 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.50 Å
9DUB Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound SRM-25-071 Deposited 2024-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：protein kinase domain (UNP residues 2-285)	Not recorded	A1BB7 4-(pyridin-4-yl)pyridazine × 1 CL CHLORIDE ION × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；Protein: 6.6 mg/ml, 0.25M Sodium chloride, 0.1M Tris-HCl (pH 8.0); Screen: 1.8M Ammomium sulfate, 0.2M Ammonium chloride; Soak: 24h, 1mM SRM-25-071, 10% DMSO, 1.8M Ammonium sulfate, 0.2M Ammonium chloride; Cryo: 1.8M Ammonium sulfate, 25% sucrose.	Resolution 1.50 Å R-free 0.183
9DUE Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound SRM-07-081a Deposited 2024-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：protein kinase domain (UNP residues 2-285)	Not recorded	A1BB6 3-chloro-6-(4-methylpiperazin-1-yl)-4-(pyridin-4-yl)pyridazine × 1 BO3 BORIC ACID × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；Protein: 6.6 mg/ml, 0.25M Sodium chloride, 0.1M Tris-HCl (pH 8.0); Screen: 1.8M Ammomium sulfate, 0.2M Ammonium chloride; Soak: 24h, 1mM SRM-7-081a, 10% DMSO, 1.8M Ammonium sulfate, 0.2M Ammonium chloride; Cryo: 1.8M Ammonium sulfate, 25% sucrose.	Resolution 1.65 Å R-free 0.184
9INV Crystal structure of DAPK1 in complex with isoliquiritigenin Deposited 2024-07-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	HCC 2',4,4'-TRIHYDROXYCHALCONE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 400, ammonium sulfate, MES pH 6.5	Resolution 1.61 Å R-free 0.205
9INW Crystal structure of DAPK1 in complex with compound 9 Deposited 2024-07-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	A1L2V (~{E})-1-[2,4-bis(oxidanyl)phenyl]-3-(3-chloranyl-4-oxidanyl-phenyl)prop-2-en-1-one × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 400, ammonium sulfate, MES pH 6.5	Resolution 1.52 Å R-free 0.207
9INX Crystal structure of DAPK1 in complex with compound 10 Deposited 2024-07-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–285（285 aa）	Not recorded	A1L2W (~{E})-1-[2,4-bis(oxidanyl)phenyl]-3-(3-bromanyl-4-oxidanyl-phenyl)prop-2-en-1-one × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 400, ammonium sulfate, MES pH 6.5	Resolution 1.72 Å R-free 0.211
9MIU Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-9-039SRM. Deposited 2024-12-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa）	Not recorded	A1BLJ 6-chloro-N,N-dimethyl-5-(pyridin-4-yl)pyridazin-3-amine × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；292 K；Protein: 6.6 mg/ml, 0.25M Sodium chloride, 0.1M Tris-HCl (pH 8.0); Screen: 1.8M Ammomium sulfate, 0.2M Ammonium chloride; Soak: 24h, 1mM MW01-9-039SRM, 10% DMSO, 1.8M Ammonium sulfate, 0.2M Ammonium chloride; Cryo: 1.8M Ammonium sulfate, 25% sucrose.	Resolution 1.90 Å R-free 0.197
9N1T Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound SRM-26-100 Deposited 2025-01-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa）	Not recorded	SO4 SULFATE ION × 1 A1BU8 3-(4-methylpiperazin-1-yl)-5-(pyridin-4-yl)pyridazine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；Protein: 6.6 mg/ml, 0.25M Sodium chloride, 0.1M Tris-HCl (pH 8.0); Screen: 1.8M Ammomium sulfate, 0.2M Ammonium chloride; Soak: 24h, 1mM SRM-25-071, 10% DMSO, 1.8M Ammonium sulfate, 0.2M Ammonium chloride; Cryo: 1.8M Ammonium sulfate, 25% sucrose.	Resolution 1.43 Å R-free 0.176
9N2M Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-30-047SRM Deposited 2025-01-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa）	Not recorded	SO4 SULFATE ION × 1 A1BVM 5-(pyridin-4-yl)-3-[4-(pyridin-4-yl)piperazin-1-yl]pyridazine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；2M LiSO4, 5% DMSO	Resolution 1.35 Å R-free 0.177
9N2O Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-27-040SRM Deposited 2025-01-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa）	Not recorded	A1BVL 5-(pyridin-4-yl)-3-[4-(pyrimidin-2-yl)piperazin-1-yl]pyridazine × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；3.6M Ammonium Sulfate	Resolution 1.49 Å R-free 0.191
9O73 Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-30-035SRM Deposited 2025-04-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–285（284 aa） Fragment：protein kinase domain (UNP residues 2-285)	Not recorded	86Q 5,6-Dihydro-benzo[H]cinnolin-3-ylamine × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；2M LiSO4, 5mM MW01-30-035SRM	Resolution 1.49 Å R-free 0.191

77 other PDB entries and 81 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	DAPK1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 553–572； UniProt 300–319

Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1

Mus musculus

UniProt Q60837

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 其他Polymer 2 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain C； UniProt 20–561	Not recorded	Interleukin-12 subunit alpha × 1 （P43431） Interleukin-12 subunit beta × 1 （P43432） Interleukin-12 receptor subunit beta-2,Calmodulin-1 × 1 （P97378,P0DP23） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions：Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 4.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OE0	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8CR5 Murine Interleukin-12 receptor beta 1 domain 1 in complex with murine Interleukin-12 beta. Deposited 2023-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 20–258（239 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；(BCS E4) 20% PEG smear medium, 0.1M MgCl2, 0.1 M KCl, 0.1M PIPES pH 7.0	Resolution 2.15 Å R-free 0.282
8ODZ Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1). Deposited 2023-03-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 20–561（542 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.60 Å
8PB1 Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1), obtained after local refinement. Deposited 2023-06-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 20–561（542 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.50 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I12R1_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–542； UniProt 20–561

Interleukin-12 receptor subunit beta-2,Calmodulin-1

Mus musculus

UniProt P0DP23

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 其他Polymer 2 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain D； UniProt 5–149	Not recorded	Interleukin-12 subunit alpha × 1 （P43431） Interleukin-12 subunit beta × 1 （P43432） Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1 × 1 （Q60837,P53355） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions：Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 4.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OE0	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
12DK structure of human KCNQ1-CaM-PIP2 intermediate state Deposited 2026-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
22RJ Human KCNQ3-CaM in apo state Deposited 2026-01-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.82 Å
2KUG Halothane binds to druggable sites in calcium-calmodulin: Solution Structure of halothane-CaM N-terminal domain Deposited 2010-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 2 HLT 2-BROMO-2-CHLORO-1,1,1-TRIFLUOROETHANE × 1	SOLUTION NMR NMR measurement conditions pH 7.2；298 K；Ionic strength (raw mmCIF value) 0.1；Pressure ambient NMR sample composition 2 mM [U-99% 13C; U-99% 15N] CALMODULIN, 20 mM CALCIUM ION, 20 mM N-{[2-({[1-(4-CARBOXYBUTANOYL)AMINO]-2-PHENYLETHYL}-HYDROXYPHOSPHINYL)OXY]ACETYL}-2-PHENYLETHYLAMINE, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 2 mM [U-99% 15N] CALMODULIN, 20 mM CALCIUM ION, 20 mM N-{[2-({[1-(4-CARBOXYBUTANOYL)AMINO]-2-PHENYLETHYL}-HYDROXYPHOSPHINYL)OXY]ACETYL}-2-PHENYLETHYLAMINE, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
3EVV Crystal Structure of Calcium bound dimeric GCAMP2 (#2) Deposited 2008-10-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 5–149（145 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 8	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å R-free 0.270
3O77 The structure of Ca2+ Sensor (Case-16) Deposited 2010-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–149（147 aa）	Mutation：POINT MUTATIONS Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 SO4 SULFATE ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；Reservoir: 50mM Imidazol, 1.9M Na2malonate pH 6.4; Protein stock solution: 50mM Tris HCl (pH 7.4), 150mM NaCl, 10mM dithiothreitol, protein 4.1mg/ml; Drop ratio reservoir/protein = 1/3, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.35 Å R-free 0.274
3O78 The structure of Ca2+ Sensor (Case-12) Deposited 2010-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–149（147 aa）	Mutation：POINT MUTATIONS Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；Reservoir: 100mM Tris HCL (pH 5.5), 100mM (NH4)2SO4, 21% PEG 3350; Protein stock: 7.6 mg/ml Protein, 50mM Tris HCl (pH 7.4), 150mM NaCl; Seed stock solution: 20mM CaCl2, 20% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.316
3O78 The structure of Ca2+ Sensor (Case-12) Deposited 2010-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 3–149（147 aa）	Mutation：POINT MUTATIONS Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；Reservoir: 100mM Tris HCL (pH 5.5), 100mM (NH4)2SO4, 21% PEG 3350; Protein stock: 7.6 mg/ml Protein, 50mM Tris HCl (pH 7.4), 150mM NaCl; Seed stock solution: 20mM CaCl2, 20% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.316
3O78 The structure of Ca2+ Sensor (Case-12) Deposited 2010-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 3–149（147 aa） Chain B 3–149（147 aa）	Mutation：POINT MUTATIONS Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：POINT MUTATIONS Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；Reservoir: 100mM Tris HCL (pH 5.5), 100mM (NH4)2SO4, 21% PEG 3350; Protein stock: 7.6 mg/ml Protein, 50mM Tris HCl (pH 7.4), 150mM NaCl; Seed stock solution: 20mM CaCl2, 20% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.316
5OEO Solution structure of the complex of TRPV5(655-725) with a Calmodulin E32Q/E68Q double mutant Deposited 2017-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Mutation：E32Q, E68Q	CA CALCIUM ION × 2	SOLUTION NMR NMR measurement conditions pH 7.4；308 K；Ionic strength (raw mmCIF value) 84；Pressure 1 NMR sample composition 220 uM 13C/15N Calmodulin, 220 uM hTRPV5(655-725), 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 380 uM [U-99% 15N] Calmodulin, 380 uM [U-99% 13C; U-99% 15N] hTRPV5(655-725), 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
5V02 A positive allosteric modulator binding pocket in SK2 ion channels is shared by Riluzole and CyPPA Deposited 2017-02-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 1–149（149 aa）	Not recorded	SO4 SULFATE ION × 2 657 6-(trifluoromethoxy)-1,3-benzothiazol-2-amine × 1 GOL GLYCEROL × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；ammonia sulfate	Resolution 1.78 Å R-free 0.215
5V7X Crystal Structure of Myosin 1b residues 1-728 with bound sulfate and Calmodulin Deposited 2017-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–149（149 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；10% PEG 3350, 100 mM LiOOCCH3, 100 mM HEPES, pH 7.0, 20 mM Mg2SO4	Resolution 3.14 Å R-free 0.202
5WBX Structural insights into the potency of SK/IK channel positive modulators Deposited 2017-06-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 5–148（144 aa）	Not recorded	SO4 SULFATE ION × 4 GOL GLYCEROL × 2 CA CALCIUM ION × 2 AJY (3Z)-6-bromo-3-(hydroxyimino)-5-methyl-1,3-dihydro-2H-indol-2-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；293.15 K；0.1 M Sodium itrate tribasic dihydrate 0.5 M Ammonium sulfate 1.5 M Lithium sulfate monohydrate	Resolution 1.90 Å R-free 0.243
5WBX Structural insights into the potency of SK/IK channel positive modulators Deposited 2017-06-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain R 5–148（144 aa）	Not recorded	SO4 SULFATE ION × 8 GOL GLYCEROL × 4 CA CALCIUM ION × 4 AJY (3Z)-6-bromo-3-(hydroxyimino)-5-methyl-1,3-dihydro-2H-indol-2-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；293.15 K；0.1 M Sodium itrate tribasic dihydrate 0.5 M Ammonium sulfate 1.5 M Lithium sulfate monohydrate	Resolution 1.90 Å R-free 0.243
5WC5 Structural insights into the potency of SK/IK channel positive modulators Deposited 2017-06-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 5–148（144 aa）	Not recorded	SO4 SULFATE ION × 6 GOL GLYCEROL × 1 CA CALCIUM ION × 2 AJV 7-fluoro-3-(hydroxyamino)-2H-indol-2-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；293.15 K；0.1 M Sodium citrate tribasic dihydrate 0.5 M Ammonium sulfate 1.5 M Litium sulfate monohydrate	Resolution 2.30 Å R-free 0.250
5WC5 Structural insights into the potency of SK/IK channel positive modulators Deposited 2017-06-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain R 5–148（144 aa）	Not recorded	SO4 SULFATE ION × 12 GOL GLYCEROL × 2 CA CALCIUM ION × 4 AJV 7-fluoro-3-(hydroxyamino)-2H-indol-2-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；293.15 K；0.1 M Sodium citrate tribasic dihydrate 0.5 M Ammonium sulfate 1.5 M Litium sulfate monohydrate	Resolution 2.30 Å R-free 0.250
6B8L Crystal Structure of the Apo/CaM:Kv7.4 (KCNQ4) AB Domain Complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–149（149 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5	Resolution 2.30 Å R-free 0.246
6B8L Crystal Structure of the Apo/CaM:Kv7.4 (KCNQ4) AB Domain Complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5	Resolution 2.30 Å R-free 0.246
6B8L Crystal Structure of the Apo/CaM:Kv7.4 (KCNQ4) AB Domain Complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–149（149 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5	Resolution 2.30 Å R-free 0.246
6B8L Crystal Structure of the Apo/CaM:Kv7.4 (KCNQ4) AB Domain Complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–149（149 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5	Resolution 2.30 Å R-free 0.246
6B8M Crystal Structure of the Ca2+/CaM:Kv7.4 (KCNQ4) AB Domain Complex, 1 mM CaCl2 soak Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 1mM CaCl2	Resolution 2.30 Å R-free 0.262
6B8M Crystal Structure of the Ca2+/CaM:Kv7.4 (KCNQ4) AB Domain Complex, 1 mM CaCl2 soak Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 1mM CaCl2	Resolution 2.30 Å R-free 0.262
6B8M Crystal Structure of the Ca2+/CaM:Kv7.4 (KCNQ4) AB Domain Complex, 1 mM CaCl2 soak Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–149（149 aa）	Not recorded	CA CALCIUM ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 1mM CaCl2	Resolution 2.30 Å R-free 0.262
6B8M Crystal Structure of the Ca2+/CaM:Kv7.4 (KCNQ4) AB Domain Complex, 1 mM CaCl2 soak Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 1mM CaCl2	Resolution 2.30 Å R-free 0.262
6B8N Crystal Structure of the Ca2+/CaM:Kv7.4 (KCNQ4) AB Domain Complex, 10 uM CaCl2 soak Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 0.01mM CaCl2	Resolution 2.20 Å R-free 0.264
6B8N Crystal Structure of the Ca2+/CaM:Kv7.4 (KCNQ4) AB Domain Complex, 10 uM CaCl2 soak Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 0.01mM CaCl2	Resolution 2.20 Å R-free 0.264
6B8N Crystal Structure of the Ca2+/CaM:Kv7.4 (KCNQ4) AB Domain Complex, 10 uM CaCl2 soak Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 0.01mM CaCl2	Resolution 2.20 Å R-free 0.264
6B8N Crystal Structure of the Ca2+/CaM:Kv7.4 (KCNQ4) AB Domain Complex, 10 uM CaCl2 soak Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 0.01mM CaCl2	Resolution 2.20 Å R-free 0.264
6B8P Crystal Structure of the Mg2+/CaM:Kv7.4 (KCNQ4) AB domain complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 1mM MgCl2	Resolution 2.20 Å R-free 0.240
6B8P Crystal Structure of the Mg2+/CaM:Kv7.4 (KCNQ4) AB domain complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 1mM MgCl2	Resolution 2.20 Å R-free 0.240
6B8P Crystal Structure of the Mg2+/CaM:Kv7.4 (KCNQ4) AB domain complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 1mM MgCl2	Resolution 2.20 Å R-free 0.240
6B8P Crystal Structure of the Mg2+/CaM:Kv7.4 (KCNQ4) AB domain complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；2M ammonium sulfate, 0.1M BisTris pH 6.5, 1mM MgCl2	Resolution 2.20 Å R-free 0.240
6B8Q Crystal Structure of the Mg2+/CaM:Kv7.5 (KCNQ5) AB domain complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2M magnesium formate, 20% PEG 3350	Resolution 2.60 Å R-free 0.270
6B8Q Crystal Structure of the Mg2+/CaM:Kv7.5 (KCNQ5) AB domain complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2M magnesium formate, 20% PEG 3350	Resolution 2.60 Å R-free 0.270
6B8Q Crystal Structure of the Mg2+/CaM:Kv7.5 (KCNQ5) AB domain complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2M magnesium formate, 20% PEG 3350	Resolution 2.60 Å R-free 0.270
6B8Q Crystal Structure of the Mg2+/CaM:Kv7.5 (KCNQ5) AB domain complex Deposited 2017-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2M magnesium formate, 20% PEG 3350	Resolution 2.60 Å R-free 0.270
6BUT Solution structure of full-length apo mammalian calmodulin bound to the IQ motif of the human voltage-gated sodium channel NaV1.2 Deposited 2017-12-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR sample composition 0.950 mM U-99% C13, U-99% N15 Calmodulin, 0.950 mM U-99% C13, U-99% N15 voltage-gated sodium channel NaV1.2 IQ motif, 0.1 mM U-98% 2H EDTA, 100 mM KCl, 10 mM [U-99% 2H] imidazole, 0.01 % w/v sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.95 mM U-99% C13, U-99% N15 Calmodulin, 0.95 mM U-99% C13, U-99% N15 voltage-gated sodium channel NaV1.2 IQ motif, 0.1 mM U-98% 2H EDTA, 100 mM potassium chloride, 10 mM [U-99% 2H] imidazole, 0.01 % w/v sodium azide, 100% D2O \| 100% D2O	Resolution not provided
6CNM Cryo-EM structure of the human SK4/calmodulin channel complex Deposited 2018-03-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	K POTASSIUM ION × 5 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 4 LMT DODECYL-BETA-D-MALTOSIDE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6CNN Cryo-EM structure of the human SK4/calmodulin channel complex in the Ca2+ bound state I Deposited 2018-03-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	K POTASSIUM ION × 4 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 4 LMT DODECYL-BETA-D-MALTOSIDE × 8 CA CALCIUM ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6CNO Cryo-EM structure of the human SK4/calmodulin channel complex in the Ca2+ bound state II Deposited 2018-03-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
6DAD 1.65 Angstrom crystal structure of the N97I Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Mutation：N97I	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；2.1 M sodium malonate, 0.1 M HEPES, pH 7.5	Resolution 1.65 Å R-free 0.208
6DAD 1.65 Angstrom crystal structure of the N97I Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Mutation：N97I	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；2.1 M sodium malonate, 0.1 M HEPES, pH 7.5	Resolution 1.65 Å R-free 0.208
6DAE 2.0 Angstrom crystal structure of the D95V Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Mutation：D95V	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.3；277 K；1 M lithium chloride, 30% PEG6000, 0.1M Bicine, pH 10.3	Resolution 2.00 Å R-free 0.226
6DAE 2.0 Angstrom crystal structure of the D95V Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Mutation：D95V	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.3；277 K；1 M lithium chloride, 30% PEG6000, 0.1M Bicine, pH 10.3	Resolution 2.00 Å R-free 0.226
6DAF 2.4 Angstrom crystal structure of the F141L Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Mutation：F141L	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.5 M potassium nitrate, 20% PEG3350	Resolution 2.40 Å R-free 0.243
6DAF 2.4 Angstrom crystal structure of the F141L Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Mutation：F141L	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.5 M potassium nitrate, 20% PEG3350	Resolution 2.40 Å R-free 0.243
6DAH 2.5 Angstrom crystal structure of the N97S CaM mutant Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–149（149 aa）	Mutation：N97S	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG3350, 0.1 M Bis-Tris, pH 6.5	Resolution 2.50 Å R-free 0.279
6DAH 2.5 Angstrom crystal structure of the N97S CaM mutant Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–149（149 aa）	Mutation：N97S	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG3350, 0.1 M Bis-Tris, pH 6.5	Resolution 2.50 Å R-free 0.279
6DAH 2.5 Angstrom crystal structure of the N97S CaM mutant Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–149（149 aa）	Mutation：N97S	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG3350, 0.1 M Bis-Tris, pH 6.5	Resolution 2.50 Å R-free 0.279
6DAH 2.5 Angstrom crystal structure of the N97S CaM mutant Deposited 2018-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–149（149 aa）	Mutation：N97S	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG3350, 0.1 M Bis-Tris, pH 6.5	Resolution 2.50 Å R-free 0.279
6E2F Cryo-EM structure of human TRPV6 in complex with Calmodulin Deposited 2018-07-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–149（149 aa）	Not recorded	CA CALCIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6E2G Cryo-EM structure of rat TRPV6 in complex with Calmodulin Deposited 2018-07-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–149（149 aa）	Not recorded	CA CALCIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6EEB Calmodulin in complex with malbrancheamide Deposited 2018-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–149（149 aa）	Not recorded	J6P (5aS,12aS,13aS)-8,9-dichloro-12,12-dimethyl-2,3,11,12,12a,13-hexahydro-1H,5H,6H-5a,13a-(epiminomethano)indolizino[7,6-b]carbazol-14-one × 1 CA CALCIUM ION × 4 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.1 M Tris pH 8.5, 0.2 M MgCl2, 20% (w/v) PEG 8000	Resolution 1.96 Å R-free 0.263
6EEB Calmodulin in complex with malbrancheamide Deposited 2018-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	J6P (5aS,12aS,13aS)-8,9-dichloro-12,12-dimethyl-2,3,11,12,12a,13-hexahydro-1H,5H,6H-5a,13a-(epiminomethano)indolizino[7,6-b]carbazol-14-one × 2 CA CALCIUM ION × 8 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.1 M Tris pH 8.5, 0.2 M MgCl2, 20% (w/v) PEG 8000	Resolution 1.96 Å R-free 0.263
6FEG Solution Structure of CaM/Kv7.2-hAB Complex Deposited 2018-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–149（149 aa）	Not recorded	CA CALCIUM ION × 2	SOLUTION NMR NMR measurement conditions pH 6；303 K；Ionic strength (raw mmCIF value) 120；Pressure 1 NMR sample composition 1 mM [U-100% 13C; U-100% 15N; U-50% 2H] Kv7.2-hAB, 1 mM [U-100% 13C; U-100% 15N; U-50% 2H] Calmodulin, 120 mM potassium chloride, 20 mM MES, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 500 uM [U-100% 13C; U-100% 15N] Kv7.2-hAB, 500 uM Calmodulin, 120 mM potassium chloride, 20 mM MES, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 500 uM Kv7.2-hAB, 500 uM [U-100% 13C; U-100% 15N] Calmodulin, 120 mM potassium chloride, 20 mM MES, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 250 uM [U-100% 15N] Kv7.2-hAB, 250 uM [U-100% 15N] Calmodulin, 120 mM potassium chloride, 20 mM MES, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6FEH Solution Structure of CaM/Kv7.2-hAB Complex Deposited 2018-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	SOLUTION NMR NMR measurement conditions pH 6；303 K；Ionic strength (raw mmCIF value) 120；Pressure 1 NMR sample composition 1 mM [U-100% 13C; U-100% 15N; U-50% 2H] Kv7.2-hAB, 1 mM [U-100% 13C; U-100% 15N; U-50% 2H] Calmodulin, 120 mM potassium chloride, 20 mM MES, 5 mM CaCl2, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 500 uM [U-100% 13C; U-100% 15N] Kv7.2-hAB, 500 uM Calmodulin, 120 mM potassium chloride, 20 mM MES, 5 mM CaCl2, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 250 uM [U-100% 15N] Kv7.2-hAB, 250 uM [U-100% 15N] Calmodulin, 120 mM potassium chloride, 20 mM MES, 5 mM CaCl2, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6GDK Calcium bound form of human calmodulin mutant F141L Deposited 2018-04-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Mutation：F141L	CA CALCIUM ION × 4	SOLUTION NMR NMR measurement conditions pH 6.45；298.1 K；Ionic strength (raw mmCIF value) 24；Pressure 1 NMR sample composition 0.53 mM [U-13C; U-15N] Calmodulin mutant F141L, 10 mM NA calcium chloride, 10 mM NA potassium chloride, 2 mM NA HEPES, 2 mM NA sodium azide, 0.1 mM NA TSP-d4, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6GDL Calmodulin mutant - F141L apo-form Unstructured C-domain Deposited 2018-04-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Mutation：F141L	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.55；298.1 K；Ionic strength (raw mmCIF value) 24；Pressure 1 NMR sample composition 580 uM [U-99% 13C; U-99% 15N] Calmodulin, 2 mM HEPES, 10 mM potassium chloride, 10 mM EDTA, 2 mM sodium azide, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6HCS Crystal structure of CaM-peptide complex containing AzF at position 108 Deposited 2018-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；PEG 6000, lithium chloride, sodium chloride	Resolution 2.00 Å R-free 0.294
6HCS Crystal structure of CaM-peptide complex containing AzF at position 108 Deposited 2018-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；PEG 6000, lithium chloride, sodium chloride	Resolution 2.00 Å R-free 0.294
6HCS Crystal structure of CaM-peptide complex containing AzF at position 108 Deposited 2018-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–149（149 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；PEG 6000, lithium chloride, sodium chloride	Resolution 2.00 Å R-free 0.294
6HCS Crystal structure of CaM-peptide complex containing AzF at position 108 Deposited 2018-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–149（149 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；PEG 6000, lithium chloride, sodium chloride	Resolution 2.00 Å R-free 0.294
6HR1 Crystal structure of the YFPnano fusion protein Deposited 2018-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	TLA L(+)-TARTARIC ACID × 1 CA CALCIUM ION × 4 EDO 1,2-ETHANEDIOL × 2 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.8；293 K；24% w/v PEG 3350 0.2 M di-Ammonium tartrate 10% v/v Glycerol	Resolution 1.90 Å R-free 0.214
6HR1 Crystal structure of the YFPnano fusion protein Deposited 2018-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–149（148 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4 EDO 1,2-ETHANEDIOL × 7 GOL GLYCEROL × 2 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.8；293 K；24% w/v PEG 3350 0.2 M di-Ammonium tartrate 10% v/v Glycerol	Resolution 1.90 Å R-free 0.214
6JI8 Structure of RyR2 (F/apoCaM dataset) Deposited 2019-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–149（149 aa） Chain F 1–149（149 aa） Chain I 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6JII Structure of RyR2 (F/A/C/L-Ca2+/apo-CaM-M dataset) Deposited 2019-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–149（149 aa） Chain F 1–149（149 aa） Chain I 1–149（149 aa） Chain L 1–149（149 aa）	Mutation：E32A,E68A,E105A,E141A Mutation：E32A,E68A,E105A,E141A Mutation：E32A,E68A,E105A,E141A Mutation：E32A,E68A,E105A,E141A	ZN ZINC ION × 4 CA CALCIUM ION × 4 CFF CAFFEINE × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6JIU Structure of RyR2 (F/A/C/L-Ca2+/Ca2+CaM dataset) Deposited 2019-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–149（149 aa） Chain F 1–149（149 aa） Chain I 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	ZN ZINC ION × 4 CA CALCIUM ION × 12 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6JIY Structure of RyR2 (F/A/C/H-Ca2+/Ca2+CaM dataset) Deposited 2019-02-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–149（149 aa） Chain F 1–149（149 aa） Chain I 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	ZN ZINC ION × 4 CA CALCIUM ION × 20 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6JRS Structure of RyR2 (*F/A/C/L-Ca2+/Ca2+-CaM dataset) Deposited 2019-04-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–149（149 aa） Chain F 1–149（149 aa） Chain I 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	ZN ZINC ION × 4 CA CALCIUM ION × 12 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6JV2 Structure of RyR2 (P/L-Ca2+/Ca2+-CaM dataset) Deposited 2019-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	ZN ZINC ION × 4 CA CALCIUM ION × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
6K4K Crystal structure of SidJ-CaM binary complex at 2.71 A Deposited 2019-05-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；299 K；20% PEG 3350, 0.2M NaI	Resolution 2.71 Å R-free 0.243
6K4K Crystal structure of SidJ-CaM binary complex at 2.71 A Deposited 2019-05-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；299 K；20% PEG 3350, 0.2M NaI	Resolution 2.71 Å R-free 0.243
6K4L Crystal structure of Se-labelled SidJ complex with CaM at 2.95 A Deposited 2019-05-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Not recorded	CL CHLORIDE ION × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；299 K；25% PEG 3350, 0.2M NaI	Resolution 2.95 Å R-free 0.269
6K4L Crystal structure of Se-labelled SidJ complex with CaM at 2.95 A Deposited 2019-05-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	CL CHLORIDE ION × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；299 K；25% PEG 3350, 0.2M NaI	Resolution 2.95 Å R-free 0.269
6K4R Crystal structure of SidJ-CaM-AMP ternary complex at 3.11 A Deposited 2019-05-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1 CL CHLORIDE ION × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；299 K；25% PEG 3350, 0.2M NaI, 0.1M HEPES 7.5	Resolution 3.11 Å R-free 0.279
6K4R Crystal structure of SidJ-CaM-AMP ternary complex at 3.11 A Deposited 2019-05-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1 CL CHLORIDE ION × 2 PG4 TETRAETHYLENE GLYCOL × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；299 K；25% PEG 3350, 0.2M NaI, 0.1M HEPES 7.5	Resolution 3.11 Å R-free 0.279
6M2W Structure of RyR1 (Ca2+/Caffeine/ATP/CaM1234/CHL) Deposited 2020-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–149（149 aa） Chain F 1–149（149 aa） Chain I 1–149（149 aa） Chain L 1–149（149 aa）	Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A	CFF CAFFEINE × 4 CA CALCIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 ZN ZINC ION × 4 F0U 5-bromanyl-N-[4-chloranyl-2-methyl-6-(methylcarbamoyl)phenyl]-2-(3-chloranylpyridin-2-yl)pyrazole-3-carboxamide × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6M7H Structure of calmodulin with KN93 Deposited 2018-08-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–148（147 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	KN9 N-[2-[[[3-(4'-Chlorophenyl)-2-propenyl]methylamino]methyl]phenyl]-N-(2-hydroxyethyl)-4'-methoxybenzenesulfonamide × 3 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；bis tris ph 6.5, peg 3350	Resolution 1.60 Å R-free 0.267
6MUD Voltage-gated sodium channel NaV1.5 C-terminal domain in complex with Ca2+/Calmodulin Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；277 K；5-15 % (w/v) PEG 4000, 0.1 M Tris, pH 9.5, 0.1 M MgCl2, and 5 % (v/v) isopropanol	Resolution 2.69 Å R-free 0.269
6MUE Voltage-gated sodium channel NaV1.4 IQ domain in complex with Ca2+/Calmodulin Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；0.1 M MES pH 6.0 and 55 % (v/v) isopropanol	Resolution 1.90 Å R-free 0.260
6N5W Crystal structure of the Ca2+/CaM complex with independent peptides of Kv7.4 (KCNQ4) A & B domains Deposited 2018-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–149（149 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；1.3 M sodium citrate, 0.1 M HEPES pH 7.0	Resolution 2.15 Å R-free 0.274
6O5G Calmodulin in complex with isomalbrancheamide D Deposited 2019-03-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–149（149 aa）	Not recorded	LMJ (5aS,12aS,13aS)-9-bromo-8-chloro-12,12-dimethyl-2,3,11,12,12a,13-hexahydro-1H,5H,6H-5a,13a-(epiminomethano)indolizino[7 ,6-b]carbazol-14-one × 1 CA CALCIUM ION × 4 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.1 M Tris pH 8.5, 0.2 M MgCl2, 20% PEG 8000	Resolution 1.89 Å R-free 0.226
6OS4 Calmodulin in complex with farnesyl cysteine methyl ester Deposited 2019-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4 5U0 s-farnesyl-l-cysteine methyl ester × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；293 K；0.2mM sodium acetate, 0.1mM cacodylate, 28% PEG 8000	Resolution 2.05 Å R-free 0.225
6OS4 Calmodulin in complex with farnesyl cysteine methyl ester Deposited 2019-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 8 5U0 s-farnesyl-l-cysteine methyl ester × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；293 K；0.2mM sodium acetate, 0.1mM cacodylate, 28% PEG 8000	Resolution 2.05 Å R-free 0.225
6PAW Crystal structure of DAPK2 S308A Calcium/Calmodulin complex Deposited 2019-06-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292.15 K；0.1 M Bis-Tris-HCl, pH 6.5, 0.6 M sodium chloride, 14.3% PEG3350	Resolution 2.95 Å R-free 0.288
6PAW Crystal structure of DAPK2 S308A Calcium/Calmodulin complex Deposited 2019-06-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292.15 K；0.1 M Bis-Tris-HCl, pH 6.5, 0.6 M sodium chloride, 14.3% PEG3350	Resolution 2.95 Å R-free 0.288
6PAW Crystal structure of DAPK2 S308A Calcium/Calmodulin complex Deposited 2019-06-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292.15 K；0.1 M Bis-Tris-HCl, pH 6.5, 0.6 M sodium chloride, 14.3% PEG3350	Resolution 2.95 Å R-free 0.288
6PAW Crystal structure of DAPK2 S308A Calcium/Calmodulin complex Deposited 2019-06-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–149（149 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292.15 K；0.1 M Bis-Tris-HCl, pH 6.5, 0.6 M sodium chloride, 14.3% PEG3350	Resolution 2.95 Å R-free 0.288
6PBX Single particle cryo-EM structure of the voltage-gated K+ channel Eag1 3-13 deletion mutant bound to calmodulin (conformation 2) Deposited 2019-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6PBY Single particle cryo-EM structure of the voltage-gated K+ channel Eag1 3-13 deletion mutant bound to calmodulin (conformation 1) Deposited 2019-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Q 2–149（148 aa）	Mutation：D129G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U3A 1.65 Angstrom crystal structure of the N97S Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Mutation：N97S	CA CALCIUM ION × 3 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；DL-malic acid	Resolution 1.65 Å R-free 0.209
6U3A 1.65 Angstrom crystal structure of the N97S Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Mutation：N97S	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；DL-malic acid	Resolution 1.65 Å R-free 0.209
6U3B 1.7 Angstrom crystal structure of the Q135P Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Mutation：Q135P	CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；PEG 550 MME, sodium acetate	Resolution 1.70 Å R-free 0.200
6U3D 1.75 Angstrom crystal structure of the N53I Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Mutation：N53I	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；PEG 3350, citric acid	Resolution 1.75 Å R-free 0.201
6U3D 1.75 Angstrom crystal structure of the N53I Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Mutation：N53I	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；PEG 3350, citric acid	Resolution 1.75 Å R-free 0.201
6UZZ structure of human KCNQ1-CaM complex Deposited 2019-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6V00 structure of human KCNQ1-KCNE3-CaM complex Deposited 2019-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–149（149 aa） Chain E 1–149（149 aa） Chain H 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6V01 structure of human KCNQ1-KCNE3-CaM complex with PIP2 Deposited 2019-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–149（149 aa） Chain E 1–149（149 aa） Chain H 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	CA CALCIUM ION × 8 PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6X32 Wt pig RyR1 in complex with apoCaM, EGTA condition (class 1 and 2, closed) Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 3–148（146 aa） Chain F 3–148（146 aa） Chain I 3–148（146 aa） Chain L 3–148（146 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6X33 Wt pig RyR1 in complex with apoCaM, EGTA condition (class 3, open) Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–148（148 aa） Chain F 1–148（148 aa） Chain I 1–148（148 aa） Chain L 1–148（148 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6X35 Pig R615C RyR1 in complex with CaM, EGTA (class 1, open) Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–148（148 aa） Chain F 1–148（148 aa） Chain I 1–148（148 aa） Chain L 1–148（148 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6X36 Pig R615C RyR1 in complex with CaM, EGTA (class 3, closed) Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–148（148 aa） Chain F 1–148（148 aa） Chain I 1–148（148 aa） Chain L 1–148（148 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
6XXX 1.25 Angstrom crystal structure of Ca/CaM A102V:RyR2 peptide complex Deposited 2020-01-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain AAA 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M Sodium acetate trihydrate pH 4.0, 25% w/v Polyethylene glycol 1,500	Resolution 1.25 Å R-free 0.189
6XY3 2.0 Angstrom crystal structure of Ca/CaM N53I:RyR2 peptide complex Deposited 2020-01-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain AAA 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M Sodium acetate trihydrate pH 4.5, 10% w/v Polyethylene glycol 10,000	Resolution 2.00 Å R-free 0.260
6XYR Structure of the T4Lnano fusion protein Deposited 2020-01-31	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 5 GOL GLYCEROL × 5 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；8% PEG 8000, 200 mM LiCl2, 100 mM Tris pH 8.0, 15% Glycerol	Resolution 2.08 Å R-free 0.236
6Y4P Calmodulin N53I variant bound to cardiac ryanodine receptor (RyR2) calmodulin binding domain Deposited 2020-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Mutation：N53I	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1 M Sodium Acetate pH 4.70 and 23 % PEG 550 MME	Resolution 2.13 Å R-free 0.246
6Y94 Ca2+-bound Calmodulin mutant N53I Deposited 2020-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Mutation：N53I	CA CALCIUM ION × 4	SOLUTION NMR NMR measurement conditions pH 6.57；298.1 K；Ionic strength (raw mmCIF value) 182；Pressure 1 NMR measurement conditions pH 6.57；298.1 K；Ionic strength (raw mmCIF value) 42；Pressure 1 NMR measurement conditions pH 6.57；298.1 K；Ionic strength (raw mmCIF value) 42；Pressure 1 NMR sample composition 0.56 mM [U-99% 13C; U-99% 15N] Calmodulin N53I, 2 mM HEPES, 100 mM potassium chloride, 10 mM calcium chloride, 50 mM sodium acetate, 2 mM sodium azide, 0.05 mM TSP, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1.0 mM [U-99% 15N] Calmodulin N53I, 2 mM HEPES, 10 mM potassium chloride, 10 mM calcium chloride, 2 mM sodium azide, 0.05 mM TSP, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1.0 mM [U-99% 13C; U-99% 15N] Calmodulin, 2 mM HEPES, 10 mM potassium chloride, 10 mM calcium chloride, 2 mM sodium azide, 0.05 mM TSP, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6Y95 Ca2+-free Calmodulin mutant N53I Deposited 2020-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Mutation：N53I	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；298.1 K；Ionic strength (raw mmCIF value) 105；Pressure 1 NMR measurement conditions pH 6.56；298.1 K；Ionic strength (raw mmCIF value) 42；Pressure 1 NMR measurement conditions pH 6.53；298.1 K；Ionic strength (raw mmCIF value) 42；Pressure 1 NMR sample composition 1.9 mM [U-99% 13C; U-99% 15N] Calmodulin N53I, 20 mM HEPES, 100 mM potassium chloride, 1 mM EDTA, 2 mM sodium azide, 0.05 mM TSP, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1.2 mM [U-99% 15N] Calmodulin N53I, 2 mM HEPES, 10 mM potassium chloride, 10 mM EDTA, 2 mM sodium azide, 0.05 mM TSP, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1.2 mM [U-99% 13C; U-99% 15N] Calmodulin, 2 mM HEPES, 10 mM potassium chloride, 10 mM EDTA, 2 mM sodium azide, 0.05 mM TSP, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6YNS CaM-P458 complex (crystal form 2) Deposited 2020-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 2–149（148 aa） Chain C 2–149（148 aa）	Not recorded	CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；0.2M of MgCl2 0.1M HEPES-HCl pH 7.5 25% (w/v) PEG3350	Resolution 3.94 Å R-free 0.284
6YNS CaM-P458 complex (crystal form 2) Deposited 2020-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 2–149（148 aa） Chain K 2–149（148 aa）	Not recorded	CA CALCIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；0.2M of MgCl2 0.1M HEPES-HCl pH 7.5 25% (w/v) PEG3350	Resolution 3.94 Å R-free 0.284
6YNS CaM-P458 complex (crystal form 2) Deposited 2020-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 2–149（148 aa） Chain E 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；0.2M of MgCl2 0.1M HEPES-HCl pH 7.5 25% (w/v) PEG3350	Resolution 3.94 Å R-free 0.284
6YNS CaM-P458 complex (crystal form 2) Deposited 2020-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 2–149（148 aa） Chain G 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；0.2M of MgCl2 0.1M HEPES-HCl pH 7.5 25% (w/v) PEG3350	Resolution 3.94 Å R-free 0.284
6YNS CaM-P458 complex (crystal form 2) Deposited 2020-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain H 2–149（148 aa） Chain I 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；0.2M of MgCl2 0.1M HEPES-HCl pH 7.5 25% (w/v) PEG3350	Resolution 3.94 Å R-free 0.284
6YNS CaM-P458 complex (crystal form 2) Deposited 2020-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain J 2–149（148 aa） Chain L 2–149（148 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；0.2M of MgCl2 0.1M HEPES-HCl pH 7.5 25% (w/v) PEG3350	Resolution 3.94 Å R-free 0.284
6YNU CaM-P458 complex (crystal form 1) Deposited 2020-04-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；0.3 M Ammonium sulfate 30% (w/v) PEG 4000	Resolution 3.12 Å R-free 0.291
6YNU CaM-P458 complex (crystal form 1) Deposited 2020-04-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；0.3 M Ammonium sulfate 30% (w/v) PEG 4000	Resolution 3.12 Å R-free 0.291
6ZBI Ternary complex of Calmodulin bound to 2 molecules of NHE1 Deposited 2020-06-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4	SOLUTION NMR NMR measurement conditions pH 7.5；310 K；Ionic strength (raw mmCIF value) 120；Pressure 1 NMR sample composition 0.5 mM [U-99% 13C; U-99% 15N] Calmodulin, 1.15 mM Sodium/Hydrogen exchanger 1 (NHE1, SLC9A1), 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1 mM [U-99% 13C; U-99% 15N] Sodium/Hydrogen exchanger 1 (NHE1, SLC9A1), 0.5 mM Calmodulin, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
7BF1 Ca2+-Calmodulin in complex with peptide from brain-type creatine kinase in extended 1:2 binding mode Deposited 2020-12-31	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain AAA 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4 ACE ACETYL GROUP × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；25% PEG 1500, 0.1 M SPG buffer pH 4-5. CaM-CKBpeptide ratios of 1:4	Resolution 1.24 Å R-free 0.186
7BF2 Ca2+-Calmodulin in complex with human muscle form creatine kinase peptide in extended 1:2 binding mode Deposited 2020-12-31	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain AAA 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；293 K；25% PEG 1500, 0.1 M SPG buffer pH 4-5. CaM-CKBpeptide ratios of 1:4	Resolution 1.43 Å R-free 0.228
7KL5 Structure of Calmodulin Bound to the Cardiac Ryanodine Receptor (RyR2) at Residues: Phe4246 to Val4271 Deposited 2020-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	CA CALCIUM ION × 5 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；0.2M sodium acetate, 0.1M Tris pH 8.5, 30%(w/v) PEG 4000	Resolution 1.65 Å R-free 0.245
7L8V NMR Structure of half-calcified calmodulin mutant (CaMEF12) bound to the IQ-motif of CaV1.2 Deposited 2021-01-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Mutation：D21A, D23A, D25A, E32Q, D57A, D59A, N61A, E68Q	CA CALCIUM ION × 2	SOLUTION NMR NMR measurement conditions pH 7.4；303 K；Ionic strength (raw mmCIF value) 0.1；Pressure 1 NMR sample composition 0.5 mM [U-95% 15N] calmodulin, 0.75 mM IQ-motif, 10 mM TRIS, 2 mM CALCIUM ION, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-13C; U-15N] calmodulin, 0.75 mM IQ-motif, 10 mM TRIS, 2 mM CALCIUM ION, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
7PSZ Crystal structure of CaM in complex with CDZ (form 1) Deposited 2021-09-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Not recorded	85H 1-[bis(4-chlorophenyl)methyl]-3-[(2~{R})-2-(2,4-dichlorophenyl)-2-[(2,4-dichlorophenyl)methoxy]ethyl]imidazole × 1 SO4 SULFATE ION × 1 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；292 K；30 %w/v PEG 8K and 0.2 M (NH4)2SO4	Resolution 1.90 Å R-free 0.251
7PU9 Crystal structure of CaM in complex with CDZ (form 2) Deposited 2021-09-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Not recorded	85H 1-[bis(4-chlorophenyl)methyl]-3-[(2~{R})-2-(2,4-dichlorophenyl)-2-[(2,4-dichlorophenyl)methoxy]ethyl]imidazole × 2 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；292 K；0.2 M CaCl2, 0.1 M Tris pH 8.5 and 25 %w/v PEG 4K	Resolution 2.28 Å R-free 0.266
7SHQ Structure of a functional construct of eukaryotic elongation factor 2 kinase in complex with calmodulin. Deposited 2021-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Not recorded	ZN ZINC ION × 1 MG MAGNESIUM ION × 5 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 6.9；298.15 K；Cocktail solution: Peg3350: 24% MgCl2: 300 mM BisTris pH 6.9: 100 mM Protein Solution: 11 mg/mL CaM-eEF2Kp1/1 Tris pH 7.5: 20 mM NaCl: 0.1 M CaCl2: 3mM TCEP: 1mM MgCl2: 1.5 mM AMPPNP: 1.0 mM Crystallization conditions: 1/1 Protein/Cocktail under Paraffin Oil in a Greiner 72-Well microbatch plate	Resolution 2.34 Å R-free 0.252
7SX3 Human NALCN-FAM155A-UNC79-UNC80 channelosome with CaM bound, conformation 1/2 Deposited 2021-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–149（149 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 PGV (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 Y01 CHOLESTEROL HEMISUCCINATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 sec blotting	Resolution 3.10 Å
7SX4 Human NALCN-FAM155A-UNC79-UNC80 channelosome with CaM bound, conformation 2/2 Deposited 2021-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–149（149 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 1 PGV (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 1 Y01 CHOLESTEROL HEMISUCCINATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.5 sec blotting	Resolution 3.50 Å
7T2Q PEGylated Calmodulin-1 (K148U) Deposited 2021-12-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4 MG MAGNESIUM ION × 2 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.2 M Magnesium chloride hexahydrate, 0.1 M Tris pH 8.5, 20% w/v PEG 8000	Resolution 1.95 Å R-free 0.258
7T2Q PEGylated Calmodulin-1 (K148U) Deposited 2021-12-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 8 MG MAGNESIUM ION × 4 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.2 M Magnesium chloride hexahydrate, 0.1 M Tris pH 8.5, 20% w/v PEG 8000	Resolution 1.95 Å R-free 0.258
7TCI Structure of Xenopus KCNQ1-CaM in complex with ML277 Deposited 2021-12-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	I0S (2R)-N-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]-1-(4-methylbenzene-1-sulfonyl)piperidine-2-carboxamide × 4 CA CALCIUM ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7TCP Structure of Xenopus KCNQ1-CaM Deposited 2021-12-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.84 Å
7TZC A drug and ATP binding site in type 1 ryanodine receptor Deposited 2022-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–149（149 aa） Chain D 1–149（149 aa） Chain E 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	CA CALCIUM ION × 20 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 ZN ZINC ION × 4 CFF CAFFEINE × 4 KVR 4-[(7-methoxy-2,3-dihydro-1,4-benzothiazepin-4(5H)-yl)methyl]benzoic acid × 4 L9R (2S)-3-(octadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.45 Å
7U9T Structure of PKA phosphorylated human RyR2 in the closed state in the presence of Calmodulin Deposited 2022-03-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–149（149 aa） Chain J 1–149（149 aa） Chain K 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	ZN ZINC ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Xanthine was made fresh to avoid aggregation. Xanthine stock solution was 10 mM in NaOH 0.5 N. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.68 Å
7UA3 Structure of PKA phosphorylated human RyR2-R2474S in the closed state in the presence of Calmodulin Deposited 2022-03-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–149（149 aa） Chain J 1–149（149 aa） Chain K 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	ZN ZINC ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Xanthine was made fresh to avoid aggregation. Xanthine stock solution was 10 mM in NaOH 0.5 N. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
7UA4 Structure of PKA phosphorylated human RyR2-R2474S in the open state in the presence of Calmodulin Deposited 2022-03-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–149（149 aa） Chain J 1–149（149 aa） Chain K 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	ZN ZINC ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 CA CALCIUM ION × 4 XAN XANTHINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Xanthine was made fresh to avoid aggregation. Xanthine stock solution was 10 mM in NaOH 0.5 N. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.93 Å
7VMB Crystal structure of IQSEC1-IQ motif, Sec7PH tandem in complex with calmodulin Deposited 2021-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–149（149 aa）	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；289.15 K；0.1M HEPES pH 7.5, 4% w/v Polyethylene glycol 8000	Resolution 2.00 Å R-free 0.252
7VUO Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation F141L Deposited 2021-11-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–149（148 aa）	Mutation：F141L	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；0.1M Tris8.5 25% w/v Polyethylene glycol 3,350 0.2M Trimethylamine N-oxide dihydrate	Resolution 2.68 Å R-free 0.274
7VVD Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation Q135P Deposited 2021-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Mutation：Q135P	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；25% PEG 1500, 0.1M MMT pH 8.0	Resolution 3.13 Å R-free 0.274
7VVD Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation Q135P Deposited 2021-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–149（149 aa）	Mutation：Q135P	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；25% PEG 1500, 0.1M MMT pH 8.0	Resolution 3.13 Å R-free 0.274
7VVH Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation E140G Deposited 2021-11-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa） Fragment：E141G	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；291 K；25% PEG 1500, 0.1M MMT pH 9.0	Resolution 2.30 Å R-free 0.272
7WJI Architecture of the human NALCN channelosome Deposited 2022-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
7WR3 Crystal structure of MBP-fused OspC3 in complex with calmodulin Deposited 2022-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Not recorded	SO4 SULFATE ION × 2 NCA NICOTINAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% PEG3350, 0.1 M Tris pH 8.2-8.4, 0.2 M Lithium Sulfate, 0.7% 1-Butanol	Resolution 1.87 Å R-free 0.228
7WR3 Crystal structure of MBP-fused OspC3 in complex with calmodulin Deposited 2022-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Not recorded	SO4 SULFATE ION × 2 NCA NICOTINAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% PEG3350, 0.1 M Tris pH 8.2-8.4, 0.2 M Lithium Sulfate, 0.7% 1-Butanol	Resolution 1.87 Å R-free 0.228
7WR4 Crystal structure of OspC3-calmodulin-caspase-4 complex Deposited 2022-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–149（149 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；25% PEG3350, 0.1 M HEPES pH 7.4, 0.2 M Ammonium sulfate, 0.3 M NDSB-195	Resolution 2.75 Å R-free 0.270
7WR5 Crystal structure of OspC3-calmodulin-caspase-4 complex binding with 2'-aF-NAD+ Deposited 2022-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–149（149 aa）	Not recorded	5ZV [[(2~{R},3~{R},4~{S},5~{R})-5-(3-aminocarbonylpyridin-1-yl)-4-fluoranyl-3-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% PEG3350, 0.2 M Potassium acetate	Resolution 3.10 Å R-free 0.272
7WZS Crystal structure of Chromobacterium violaceum effector CopC in complex with host calmodulin and caspase-7 Deposited 2022-02-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–149（149 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；100 mM Bis-Tris propane pH 7.5, 1.5 M lithium sulfate	Resolution 3.60 Å R-free 0.314
7XN4 Cryo-EM structure of CopC-CaM-caspase-3 with NAD+ Deposited 2022-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–149（149 aa）	Not recorded	NAD NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
7XN5 Cryo-EM structure of CopC-CaM-caspase-3 with ADPR Deposited 2022-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–149（149 aa）	Not recorded	NCA NICOTINAMIDE × 1 APR ADENOSINE-5-DIPHOSPHORIBOSE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
7XN6 Cryo-EM structure of CopC-CaM-caspase-3 with ADPR-deacylization Deposited 2022-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–149（149 aa）	Not recorded	NCA NICOTINAMIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
7ZRP 2.65 Angstrom crystal structure of Ca/CaM:CaMKIIdelta peptide complex Deposited 2022-05-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4 PG4 TETRAETHYLENE GLYCOL × 2 IMD IMIDAZOLE × 1 ZN ZINC ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292 K；200 mM Zinc acetate, 100 mM Imidazole pH8.0, 18% PEG3000	Resolution 2.65 Å R-free 0.272
7ZRP 2.65 Angstrom crystal structure of Ca/CaM:CaMKIIdelta peptide complex Deposited 2022-05-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–149（148 aa）	Not recorded	CA CALCIUM ION × 4 IMD IMIDAZOLE × 1 ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292 K；200 mM Zinc acetate, 100 mM Imidazole pH8.0, 18% PEG3000	Resolution 2.65 Å R-free 0.272
7ZRQ 1.68 Angstrom crystal structure of Ca/CaM-E140G:CaMKIIdelta peptide complex Deposited 2022-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–149（148 aa）	Mutation：E140G	CA CALCIUM ION × 4 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.1 M Na+-HEPES, 0.1 M MOPS (acid), pH 7.5, 0.03 M magnesium chloride hexahydrate, 0.03 M calcium chloride dihydrate, 12.5% v/v MPD; 12.5% PEG 1000; 12.5% w/v PEG 3350	Resolution 1.68 Å R-free 0.244
8AHS Crystal structure of human Ca2+/Calmodulin in complex with melittin Deposited 2022-07-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.4；293 K；0.2M NaCl, 22w/v% PEG3350, 0.1M Bis-Tris, pH 5.4	Resolution 2.48 Å R-free 0.270
8B6Q X-ray structure of the haloalkane dehalogenase HaloTag7 with an insertion of Calmodulin-M13 fusion at position 154-156 that mimic the structure of CaProLa, an calcium gated protein labeling technology Deposited 2022-09-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–148（146 aa）	Not recorded	CL CHLORIDE ION × 1 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M MES pH 6.0, 0.2 M calcium acetate, 18% (m/v) PEG 8000	Resolution 2.60 Å R-free 0.318
8BFG Solution structure of human apo/Calmodulin G113R (G114R) Deposited 2022-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Mutation：G113R	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.64；298.1 K；Ionic strength (raw mmCIF value) 128；Pressure 1 NMR sample composition 1.2 mM aa 81-148: U-13C,15N Calmodulin G113R, 5 mM EDTA, 100 mM potassium chloride, 2 mM NaN3, 20 mM HEPES, 0.1 mM TSP-d4, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
8DGH NMR Structure of calmodulin bound to C-terminal site in the beta-subunit of cyclic nucleotide-gated channel Deposited 2022-06-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；308 K；Ionic strength (raw mmCIF value) 1；Pressure 1 NMR sample composition 0.4 mM [U-100% 13C; U-100% 15N] Calmodulin, 1.2 mM Cyclic nucleotide-gated cation channel beta-1, 20 mM [U-100% 2H] TRIS, 1 mM Calcium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.4 mM [U-100% 13C; U-100% 15N] Calmodulin, 1.2 mM Cyclic nucleotide-gated cation channel beta-1, 20 mM [U-100% 2H] TRIS, 1 mM Calcium chloride, 100% D2O \| 100% D2O	Resolution not provided
8DGK NMR structure of calmodulin bound to N-terminal site in the beta-subunit of cyclic nucleotide-gated channel Deposited 2022-06-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；308 K；Ionic strength (raw mmCIF value) 1；Pressure 1 NMR sample composition 0.5 mM [U-100% 13C; U-100% 15N] Calmodulin, 0.85 mM Cyclic nucleotide-gated cation channel beta-1, 20 mM [U-100% 2H] TRIS, 1 mM Calcium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-100% 13C; U-100% 15N] Calmodulin, 0.85 mM Cyclic nucleotide-gated cation channel beta-1, 20 mM [U-100% 2H] TRIS, 1 mM Calcium chloride, 100% D2O \| 100% D2O NMR sample composition 0.5 mM [U-10% 13C; U-100% 15N] Calmodulin, 0.85 mM Cyclic nucleotide-gated cation channel beta-1, 20 mM [U-100% 2H] TRIS, 1 mM Calcium chloride, 100% D2O \| 100% D2O	Resolution not provided
8DUJ Global map in C1 of RyR1 particles in complex with ImperaCalcin Deposited 2022-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain C 1–149（149 aa） Chain F 1–149（149 aa） Chain I 1–149（149 aa） Chain L 1–149（149 aa）	Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A	CFF CAFFEINE × 4 CA CALCIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8DVE RyR1 in presence of IpCa-T26E phosphomimetic and activating ligands Deposited 2022-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–149（149 aa） Chain F 1–149（149 aa） Chain I 1–149（149 aa） Chain L 1–149（149 aa）	Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A	CFF CAFFEINE × 4 CA CALCIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.84 Å
8EOW Eag Kv channel with voltage sensor in the up conformation Deposited 2022-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 7–148（142 aa） Chain F 7–148（142 aa） Chain G 7–148（142 aa） Chain H 7–148（142 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
8EP0 Eag Kv channel with voltage sensor in the intermediate conformation Deposited 2022-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 7–148（142 aa） Chain F 7–148（142 aa） Chain G 7–148（142 aa） Chain H 7–148（142 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.90 Å
8EP1 Eag Kv channel with voltage sensor in the down conformation Deposited 2022-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 7–148（142 aa） Chain F 7–148（142 aa） Chain G 7–148（142 aa） Chain H 7–148（142 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8FNY Nucleotide-bound structure of a functional construct of eukaryotic elongation factor 2 kinase. Deposited 2022-12-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 ZN ZINC ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；293 K；100 mM Bis-trispropane, 100 mM NaF, 20.5 % w/v PEG-3350 (2protein/1solution)	Resolution 2.22 Å R-free 0.229
8FNY Nucleotide-bound structure of a functional construct of eukaryotic elongation factor 2 kinase. Deposited 2022-12-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2–149（148 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 ZN ZINC ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；293 K；100 mM Bis-trispropane, 100 mM NaF, 20.5 % w/v PEG-3350 (2protein/1solution)	Resolution 2.22 Å R-free 0.229
8FO6 Nucleotide-free structure of a functional construct of eukaryotic elongation factor 2 kinase. Deposited 2022-12-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Not recorded	ZN ZINC ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.9；293 K；100 mM Bis-trispropane, 200 mM NaF, 17.6% PEG-3350 (2protein 1solution)	Resolution 2.55 Å R-free 0.231
8GM4 Functional construct of the Eukaryotic elongation factor 2 kinase bound to an ATP-competitive inhibitor Deposited 2023-03-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 EKI 7-amino-1-cyclopropyl-3-ethyl-2,4-dioxo-1,2,3,4-tetrahydropyrido[2,3-d]pyrimidine-6-carboxamide × 1 ZN ZINC ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.2；295.15 K；Cocktail:16.55% PEG-3350, 200 mM NaF, 100 mM BisTris-Propane Protein sol: 10.3 mg/mL 20 mM Tris pH 7.5, 100 mM NaCl, 3 mM CaCl2, 1mM TCEP, 0.3 mM ADP, 0.3 m Inhibitor , 0.7 % DMSO 2protein/1cocktail (0.2 ul total)	Resolution 2.12 Å R-free 0.238
8GM5 Functional construct of the Eukaryotic elongation factor 2 kinase bound to Calmodulin, ADP and to the A-484954 inhibitor and showing two conformations for the 498-520 loop Deposited 2023-03-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–149（148 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 EKI 7-amino-1-cyclopropyl-3-ethyl-2,4-dioxo-1,2,3,4-tetrahydropyrido[2,3-d]pyrimidine-6-carboxamide × 1 ZN ZINC ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；295.15 K；Cocktail:16.55% PEG-3350, 0.2 M NaF, 100 mM BisTris-Propane Protein solution: 10.3 mg/mL 20 mM Tris pH 7.5, 100 mM NaCl, 3 mM CaCl2, 1mM TCEP, 1.5 m Inhibitor , 3.1 % DMSO 2protein/1cocktail (0.2 ul total)	Resolution 2.12 Å R-free 0.225
8IJK human KCNQ2-CaM-Ebio1 complex in the presence of PIP2 Deposited 2023-02-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	7PN N-(1,2-dihydroacenaphthylen-5-yl)-4-fluoranyl-benzamide × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J00 Human KCNQ2-CaM in complex with CBD Deposited 2023-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	P0T cannabidiol × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8J01 Human KCNQ2-CaM in complex with CBD and PIP2 Deposited 2023-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–149（149 aa） Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	P0T cannabidiol × 8 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8J02 Human KCNQ2(F104A)-CaM-PIP2-CBD complex in state II Deposited 2023-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–149（149 aa） Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	P0T cannabidiol × 4 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8J03 Human KCNQ2(F104A)-CaM-PIP2-CBD complex in state I Deposited 2023-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa） Chain J 1–149（149 aa）	Not recorded	P0T cannabidiol × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8J04 Human KCNQ2-CaM-HN37 complex in the presence of PIP2 Deposited 2023-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–149（149 aa） Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	9MF methyl N-[4-[(4-fluorophenyl)methyl-prop-2-ynyl-amino]-2,6-dimethyl-phenyl]carbamate × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8J05 Human KCNQ2-CaM complex in the presence of PIP2 Deposited 2023-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–149（149 aa） Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8J07 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes Deposited 2023-04-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 974 PDB declaration: 974-meric	Chain W 1–149（149 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 285 MG MAGNESIUM ION × 285 GDP GUANOSINE-5'-DIPHOSPHATE × 289	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
8JFK PhK holoenzyme in inactive state, muscle isoform Deposited 2023-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 1–149（149 aa） Chain H 1–149（149 aa） Chain L 1–149（149 aa） Chain P 1–149（149 aa）	Not recorded	FAR FARNESYL × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8ODZ Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1). Deposited 2023-03-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 5–149（145 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.60 Å
8OE4 Cryo-EM structure of a pre-dimerized human IL-23 complete extracellular signaling complex. Deposited 2023-03-10	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 5–149（145 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 4.5 s. blotting time.	Resolution 3.60 Å
8PB1 Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1), obtained after local refinement. Deposited 2023-06-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 5–149（145 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.50 Å
8SIK KCNQ1 with voltage sensor in the up conformation Deposited 2023-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8SIM KCNQ1 with voltage sensor in the intermediate conformation Deposited 2023-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.20 Å
8SIN KCNQ1 with voltage sensor in the down conformation Deposited 2023-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
8UXL Structure of PKA phosphorylated human RyR2-R420W in the primed state in the presence of calcium and calmodulin Deposited 2023-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–149（149 aa） Chain J 1–149（149 aa） Chain K 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	ZN ZINC ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 CA CALCIUM ION × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；0.020 mM Calmodulin was added to the final sample cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8UXM Structure of PKA phosphorylated human RyR2-R420W in the open state in the presence of calcium and calmodulin Deposited 2023-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–149（149 aa） Chain J 1–149（149 aa） Chain K 1–149（149 aa） Chain L 1–149（149 aa）	Not recorded	CA CALCIUM ION × 20 ZN ZINC ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；0.020 mM Calmodulin was added to the final sample cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.56 Å
8W4U human KCNQ2-CaM in complex with PIP2 and HN37 Deposited 2023-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–149（149 aa） Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	9MF methyl N-[4-[(4-fluorophenyl)methyl-prop-2-ynyl-amino]-2,6-dimethyl-phenyl]carbamate × 4 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8X43 human KCNQ2-CaM-Ebio1-S1 complex in the presence of PIP2 Deposited 2023-11-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	7Q0 N-(4-azanyl-1,2-dihydroacenaphthylen-5-yl)-4-fluoranyl-benzamide × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8XJI Structure of chimeric RyR complex with flubendiamide Deposited 2023-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–148（148 aa） Chain J 1–148（148 aa） Chain K 1–148（148 aa） Chain L 1–148（148 aa）	Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A	A1LVX Flubendiamide × 4 ZN ZINC ION × 4 CA CALCIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.91 Å
8XKH Structure of chimeric RyR Complex with tetraniliprole Deposited 2023-12-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–149（149 aa） Chain J 1–149（149 aa） Chain K 1–149（149 aa） Chain L 1–149（149 aa）	Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A	ZN ZINC ION × 4 CA CALCIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4 A1LV1 tetraniliprole × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.87 Å
8XLF Structure of chimeric RyR Deposited 2023-12-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–148（148 aa） Chain J 1–148（148 aa） Chain K 1–148（148 aa） Chain L 1–148（148 aa）	Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A	CA CALCIUM ION × 4 ZN ZINC ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
8XLH Structure of chimeric RyR-I4657M/G4819E Deposited 2023-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–149（149 aa） Chain J 1–149（149 aa） Chain K 1–149（149 aa） Chain L 1–149（149 aa）	Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A	ZN ZINC ION × 4 CA CALCIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
8XO1 Human KCNQ2-CaM in complex with QO-83 Deposited 2023-12-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	A1LWZ ~{N}-[2-azanyl-3-fluoranyl-4-[[4-(trifluoromethyl)phenyl]methylamino]phenyl]-3-cyclopentyl-propanamide × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8XYA hPhK alpha-beta-gamma-delta subcomplex in inactive state Deposited 2024-01-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–149（149 aa）	Not recorded	FAR FARNESYL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8XYB hPhK gamma-delta subcomplex in inactive state Deposited 2024-01-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1–149（149 aa）	Not recorded	FAR FARNESYL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8Y40 Structure of chimeric RyR-I4657M/G4819E complex with chlorantraniliprole Deposited 2024-01-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain I 1–149（149 aa） Chain J 1–149（149 aa） Chain K 1–149（149 aa） Chain L 1–149（149 aa）	Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A Mutation：E32A, E68A, E105A, E141A	F0U 5-bromanyl-N-[4-chloranyl-2-methyl-6-(methylcarbamoyl)phenyl]-2-(3-chloranylpyridin-2-yl)pyrazole-3-carboxamide × 4 ZN ZINC ION × 4 CA CALCIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.58 Å
9CUI Structure of human full-length ancestral TRPV6 channel in Calmodulin-bound state Deposited 2024-07-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–149（149 aa）	Not recorded	Y01 CHOLESTEROL HEMISUCCINATE × 8 CLR CHOLESTEROL × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 43 CA CALCIUM ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
9CUK Structure of human full-length derived TRPV6 channel in Calmodulin-bound state Deposited 2024-07-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–149（149 aa）	Not recorded	Y01 CHOLESTEROL HEMISUCCINATE × 8 CLR CHOLESTEROL × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 43 CA CALCIUM ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
9D9Z Structure of human UBR4-KCMF1-CaM E3 ligase complex (Silencing Factor of the Integrated stress response, SiFI) Deposited 2024-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–149（149 aa） Chain D 1–149（149 aa）	Not recorded	ZN ZINC ION × 20 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9E17 Structure of RyR1 in the primed state in the presence of caffeine (reprocessed/reanalyzed from EMPIAR-10997, 7TZC, EMD-26205) Deposited 2024-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain C 1–149（149 aa） Chain D 1–149（149 aa） Chain E 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	CA CALCIUM ION × 20 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 ZN ZINC ION × 4 CFF CAFFEINE × 4 KVR 4-[(7-methoxy-2,3-dihydro-1,4-benzothiazepin-4(5H)-yl)methyl]benzoic acid × 4 L9R (2S)-3-(octadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.45 Å
9EL6 Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation F90L Deposited 2024-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；0.1M PCTP (pH8.0), 25% (w/v) PEG 1500	Resolution 2.25 Å R-free 0.301
9EL6 Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation F90L Deposited 2024-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–149（149 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；0.1M PCTP (pH8.0), 25% (w/v) PEG 1500	Resolution 2.25 Å R-free 0.301
9HXW Cryo-EM structure of the human UBR4/KCMF1/CALM1 complex (composite map) Deposited 2025-01-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa）	Not recorded	ZN ZINC ION × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9IXZ human KCNQ2-CaM-Ebio3 Complex in the Presence of PIP2 Deposited 2024-07-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	A1L3D ~{N}-[7-[bis(fluoranyl)methoxy]-1-prop-2-ynyl-indazol-3-yl]-2-propyl-pentanamide × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9J38 human KCNQ5-CaM in apo state Deposited 2024-08-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
9JQI Crystal structure of calmodulin in complex with KN93 (1:1 complex) Deposited 2024-09-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–149（149 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4 KN9 N-[2-[[[3-(4'-Chlorophenyl)-2-propenyl]methylamino]methyl]phenyl]-N-(2-hydroxyethyl)-4'-methoxybenzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；sodium acetate, sodium cacodylate, PEG 8000	Resolution 2.10 Å R-free 0.288
9JQI Crystal structure of calmodulin in complex with KN93 (1:1 complex) Deposited 2024-09-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–149（149 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4 KN9 N-[2-[[[3-(4'-Chlorophenyl)-2-propenyl]methylamino]methyl]phenyl]-N-(2-hydroxyethyl)-4'-methoxybenzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；sodium acetate, sodium cacodylate, PEG 8000	Resolution 2.10 Å R-free 0.288
9JQI Crystal structure of calmodulin in complex with KN93 (1:1 complex) Deposited 2024-09-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–149（149 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4 KN9 N-[2-[[[3-(4'-Chlorophenyl)-2-propenyl]methylamino]methyl]phenyl]-N-(2-hydroxyethyl)-4'-methoxybenzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；sodium acetate, sodium cacodylate, PEG 8000	Resolution 2.10 Å R-free 0.288
9K8W Crystal structure of the calcium indicator GCaMP6s-BrUS in calcium-bound state Deposited 2024-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Mutation：A314P/N373D/D391Y/T392R/S394T/R403G Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288 K；0.2 M Ammonium tartrate dibasic, pH 7.0, 20% PEG 3350	Resolution 2.65 Å R-free 0.236
9K8X Crystal structure of the calcium indicator GCaMP6s-BrUS-145 in calcium-bounded state Deposited 2024-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–149（148 aa）	Mutation：A313P/N372D/D390Y/T391R/S393T/R402G Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 6 CA CALCIUM ION × 4 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288 K；0.2M Sodium thiocyanate, pH 6.9, 20% PEG 3350	Resolution 2.05 Å R-free 0.251
9KUI Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation F142L Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Mutation：F142L	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1M Tris (pH8.5), 0.2 M Trimethylamine N-oxide dihydrate, 25% (w/v) PEG 3350	Resolution 2.68 Å R-free 0.275
9KUO Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation Q136P Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Mutation：Q136P	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1M MMT (pH8.0), 25% (w/v) PEG 1500	Resolution 3.13 Å R-free 0.277
9KUO Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation Q136P Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–149（149 aa）	Mutation：Q136P	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1M MMT (pH8.0), 25% (w/v) PEG 1500	Resolution 3.13 Å R-free 0.277
9KUU Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D130G Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Mutation：D130G	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1 M Tris (pH 8.5), 0.2 M Sodium acetate trihydrate, 30% (w/v) PEG4000	Resolution 2.50 Å R-free 0.262
9KUU Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D130G Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–149（149 aa）	Mutation：D130G	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1 M Tris (pH 8.5), 0.2 M Sodium acetate trihydrate, 30% (w/v) PEG4000	Resolution 2.50 Å R-free 0.262
9KUZ Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D134H Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Mutation：D134H	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1 M Hepes (pH 7.5), 25% (w/v) PEGMME2000	Resolution 2.07 Å R-free 0.268
9KUZ Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D134H Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–149（149 aa）	Mutation：D134H	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1 M Hepes (pH 7.5), 25% (w/v) PEGMME2000	Resolution 2.07 Å R-free 0.268
9KV1 Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation E141G Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Mutation：E141G	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1M MMT (pH9.0), 25% (w/v) PEG 1500	Resolution 2.30 Å R-free 0.292
9KV9 Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation E141G-Ca Deposited 2024-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Mutation：E141G	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1M MMT (pH9.0), 25% (w/v) PEG 1500	Resolution 2.05 Å R-free 0.279
9KVB Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin Deposited 2024-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.2 M NH4CH3COO (PH8.5), 27% (w/v) PEG3350	Resolution 2.77 Å R-free 0.342
9KVO Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D132E Deposited 2024-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Mutation：D132E	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1M Tris (pH8.5), 0.2M Sodium acetate trihydrate, 32% PEG4000	Resolution 3.14 Å R-free 0.345
9KVO Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D132E Deposited 2024-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–149（149 aa）	Mutation：D132E	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1M Tris (pH8.5), 0.2M Sodium acetate trihydrate, 32% PEG4000	Resolution 3.14 Å R-free 0.345
9MVW Crystal structure of S101F calmodulin - CaM:RM20 analog complex Deposited 2025-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Mutation：S101F	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；295 K；0.1M Sodium Acetate pH 4.6, 25%(w/v) PEG 4000, 20mM CaCl2	Resolution 1.58 Å R-free 0.237
9MXD Human E104A calmodulin:MLCK RM20 complex Deposited 2025-01-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Mutation：E104A	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；293 K；0.1M Sodium Acetate pH 4.6, 25%(w/v) PEG 4000, 20mM CaCl2	Resolution 1.17 Å R-free 0.178
9MY3 Structure of Xenopus KCNQ1-CaM in GDN Deposited 2025-01-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
9MY4 Structure of Xenopus KCNQ1(E150R/R221E)-CaM with the VSD in the intermediate state Deposited 2025-01-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
9NVN Structure of Nanchung-Inactive-Calmodulin in apo state Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	6OU [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate × 12 LBN 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine × 6 CA CALCIUM ION × 6 D39 (2~{S})-2-azanyl-3-[[(2~{R})-3-hexadecanoyloxy-2-[(~{Z})-octadec-9-enoyl]oxy-propoxy]-oxidanyl-phosphoryl]oxy-propanoic acid × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å
9NVO Structure of Nanchung-Inactive-Calmodulin in complex with Nicotinamide Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	6OU [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate × 14 LBN 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine × 6 NCA NICOTINAMIDE × 2 CA CALCIUM ION × 6 D39 (2~{S})-2-azanyl-3-[[(2~{R})-3-hexadecanoyloxy-2-[(~{Z})-octadec-9-enoyl]oxy-propoxy]-oxidanyl-phosphoryl]oxy-propanoic acid × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.49 Å
9NVP Structure of Nanchung-Inactive-Calmodulin in complex with Nicotinamide, EDTA Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa）	Not recorded	6OU [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate × 14 LBN 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine × 6 NCA NICOTINAMIDE × 2 D39 (2~{S})-2-azanyl-3-[[(2~{R})-3-hexadecanoyloxy-2-[(~{Z})-octadec-9-enoyl]oxy-propoxy]-oxidanyl-phosphoryl]oxy-propanoic acid × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9NVQ Structure of Nanchung-Inactive-Calmodulin in complex with Afidopyropen and calcium Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	6OU [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate × 12 LBN 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine × 6 A1B32 Afidopyropen × 2 CA CALCIUM ION × 6 D39 (2~{S})-2-azanyl-3-[[(2~{R})-3-hexadecanoyloxy-2-[(~{Z})-octadec-9-enoyl]oxy-propoxy]-oxidanyl-phosphoryl]oxy-propanoic acid × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
9NVR Structure of Nanchung-Inactive-Calmodulin in complex with Afidopyropen, EDTA Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa）	Not recorded	6OU [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate × 8 LBN 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine × 2 A1B32 Afidopyropen × 2 D39 (2~{S})-2-azanyl-3-[[(2~{R})-3-hexadecanoyloxy-2-[(~{Z})-octadec-9-enoyl]oxy-propoxy]-oxidanyl-phosphoryl]oxy-propanoic acid × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
9NWE E3 ligase UBR4-KCMF1-calmodulin complex Deposited 2025-03-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–149（149 aa） Chain D 1–149（149 aa）	Not recorded	ZN ZINC ION × 6 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9O48 Cryo-EM structure of the human SK2-4 chimera/calmodulin channel complex in the Ca2+ bound state Deposited 2025-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	K POTASSIUM ION × 2 CA CALCIUM ION × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris pH 8, 150 mM KCl, 2 mM CaCl2, 0.005% GDN, 0.0005% CHS cryo-EM vitrification conditions Cryogen ETHANE；5 uL of sample was applied to grids at 4 degree temperature with 100% humidity. After 30 seconds, grids were blotted for 5 seconds with blot force 25 and plunged into liquid ethane.	Resolution 3.10 Å
9O51 Cryo-EM structure of the human SK2-4 chimera/calmodulin channel complex in the Ca2+ free state Deposited 2025-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	K POTASSIUM ION × 2 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris pH 8, 150 mM KCl, 5 mM EGTA, 0.005% GDN, 0.0005% CHS cryo-EM vitrification conditions Cryogen ETHANE；5 uL of sample was applied to grids at 4 degree temperature with 100% humidity. After 30 seconds, grids were blotted for 5 seconds with blot force 25 and plunged into liquid ethane.	Resolution 3.40 Å
9O52 Cryo-EM structure of the human SK2-4 chimera/calmodulin channel complex bound to the bee toxin apamin Deposited 2025-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	K POTASSIUM ION × 4 CA CALCIUM ION × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris pH 8, 150 mM KCl, 2 mM CaCl2, 0.005% GDN, 0.0005% CHS cryo-EM vitrification conditions Cryogen ETHANE；5 uL of sample was applied to grids at 4 degree temperature with 100% humidity. After 30 seconds, grids were blotted for 5 seconds with blot force 25 and plunged into liquid ethane.	Resolution 3.18 Å
9O53 Cryo-EM structure of the human SK2-4 chimera/calmodulin channel complex bound to a small molecule inhibitor Deposited 2025-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	A1B8D N-(2,1,3-benzoxadiazol-4-yl)-3-(4-methoxybenzene-1-sulfonamido)benzamide × 4 K POTASSIUM ION × 4 CA CALCIUM ION × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris pH 8, 150 mM KCl, 2 mM CaCl2, 0.005% GDN, 0.0005% CHS cryo-EM vitrification conditions Cryogen ETHANE；5 uL of sample was applied to grids at 4 degree temperature with 100% humidity. After 30 seconds, grids were blotted for 5 seconds with blot force 25 and plunged into liquid ethane.	Resolution 3.30 Å
9O5O Cryo-EM structure of the human SK2-4 chimera/calmodulin channel complex bound to a small molecule activator Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	A1B8G N-(2,1,3-benzoxadiazol-4-yl)-4-(trifluoromethyl)benzamide × 4 K POTASSIUM ION × 2 CA CALCIUM ION × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris pH 8, 150 mM KCl, 2 mM CaCl2, 0.005% GDN, 0.0005% CHS cryo-EM vitrification conditions Cryogen ETHANE；5 uL of sample was applied to grids at 4 degree temperature with 100% humidity. After 30 seconds, grids were blotted for 5 seconds with blot force 25 and plunged into liquid ethane.	Resolution 3.10 Å
9OCW A constitutively active construct of eukaryotic elongation factor 2 kinase Deposited 2025-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 78–149（72 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 2 ZN ZINC ION × 1 CA CALCIUM ION × 2 MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298.15 K；2 ul of protein were mixed with 1 ul of a 18.8% PEG3350 (Hampton Research) and 314 mM magnesium acetate (pH not adjusted) solution in a 24 wells plate at room temperature	Resolution 2.27 Å R-free 0.257
9PCQ Phosphorylation of a Conserved Aspartate at the Eukaryotic Elongation Factor 2 Kinase Catalytic Site Deposited 2025-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B00A 3–149（147 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MN MANGANESE (II) ION × 2 ZN ZINC ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；298.15 K；Protein was mixed 1/1 with 100 mM BisTrisPropane, 80 mM NaF, 20% w/v PEG3350	Resolution 2.30 Å R-free 0.243
9PQH NMR Structure of Ca2+/Calmodulin bound to the GluN1 C0 domain of the NMDA receptor Deposited 2025-07-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	CA CALCIUM ION × 4	SOLUTION NMR NMR measurement conditions pH 7；308 K；Ionic strength (raw mmCIF value) 1；Pressure 1 NMR sample composition 0.4 mM [U-99% 13C; U-99% 15N] Calmodulin, 1.0 mM GluN1 C0, 1 mM Calcium chloride, 20 mM [U-99% 2H] TRIS, 93 % H2O, 7 % [U-2H] D2O, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 0.4 mM [U-99% 13C; U-99% 15N] Calmodulin, 1.0 mM GluN1 C0, 1 mM Calcium chloride, 20 mM [U-99% 2H] TRIS, 100 % [U-2H] D2O, 100% D2O \| 100% D2O	Resolution not provided
9PQI NMR Structure of Ca2+/Calmodulin bound to the GluN2A C0 domain of the NMDA receptor Deposited 2025-07-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	CA CALCIUM ION × 2	SOLUTION NMR NMR measurement conditions pH 7；308 K；Ionic strength (raw mmCIF value) 1；Pressure 1 NMR sample composition 400 uM [U-100% 13C; U-100% 15N] Calmodulin, 1 mM GluN2, 1 mM Calcium chloride, 20 mM [U-99% 2H] TRIS, 93 % H2O, 7 % [U-2H] D2O, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 400 uM [U-100% 13C; U-100% 15N] Calmodulin, 1 mM GluN2, 1 mM Calcium chloride, 20 mM [U-99% 2H] TRIS, 100 % [U-2H] D2O, 100% D2O \| 100% D2O	Resolution not provided
9QWS Cryo-EM structure of the human UBR4/KCMF1/CALM1 complex (C-term dimer interface focused refinement) Deposited 2025-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9QWU Cryo-EM structure of the human UBR4/KCMF1/CALM1 complex (CALM1 focused refinement) Deposited 2025-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9QX0 Cryo-EM structure of the human UBR4/KCMF1/CALM1 complex (C-term focused refinement) Deposited 2025-04-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain F 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9U7F structure of human KCNQ1-KCNE1-CaM complex Deposited 2025-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–149（149 aa） Chain E 1–149（149 aa） Chain H 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 4 K POTASSIUM ION × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9UC8 structure of human KCNQ1-KCNE1-CaM complex with PIP2 Deposited 2025-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–149（149 aa） Chain E 1–149（149 aa） Chain H 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 8 K POTASSIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.36 Å
9UJ4 Structure of human KCNQ1-CaM complex Deposited 2025-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	K POTASSIUM ION × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.59 Å
9UPG Cryo-EM structure of human olfactory CNGA2/A4/B1 in CaM-bound closed state Deposited 2025-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.87 Å
9VEC structure of human KCNQ1-KCNE1-CaM complex Deposited 2025-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain B 1–149（149 aa） Chain E 1–149（149 aa） Chain H 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9VEI structure of human KCNQ1-KCNE1-CaM complex with PIP2 Deposited 2025-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain B 1–149（149 aa） Chain E 1–149（149 aa） Chain H 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 8 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9VEN structure of human KCNQ1-CaM-PIP2 complex with bent conformation Deposited 2025-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	CA CALCIUM ION × 8 PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9VEO structure of human KCNQ1-CaM-PIP2 complex with straight conformation Deposited 2025-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–149（149 aa） Chain D 1–149（149 aa） Chain F 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 8 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
9VU9 channel D complex with 4 Deposited 2025-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa）	Not recorded	A1ETX (3~{S})-3-(1~{H}-benzimidazol-2-ylamino)-~{N}-(cyanomethyl)-~{N}-methyl-3-[3-(trifluoromethyl)phenyl]propanamide × 1 K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.34 Å
9VUA channel A complex with 1 Deposited 2025-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa）	Not recorded	K POTASSIUM ION × 4 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
9VUB channel C complex with 3 Deposited 2025-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 32 CLR CHOLESTEROL × 8 CA CALCIUM ION × 12 A1B92 Rimtuzalcap × 4 K POTASSIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
9VUC channel B complex with 2 Deposited 2025-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa）	Not recorded	K POTASSIUM ION × 4 Y7Z UCL1684 × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.96 Å
9WD8 structure of human KCNQ1-KCNE3-CaM complex with two PIP2 Deposited 2025-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–149（149 aa） Chain E 1–149（149 aa） Chain H 1–149（149 aa） Chain K 1–149（149 aa）	Not recorded	CA CALCIUM ION × 8 A1BBG (2R)-3-{[(S)-hydroxy{[(1R,2R,3S,4R,5R,6S)-2,3,6-trihydroxy-4,5-bis(phosphonooxy)cyclohexyl]oxy}phosphoryl]oxy}propane-1,2-diyl di[(9Z)-octadec-9-enoate] × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9X5J Cryo-EM structure of the human KCNQ2/3 heteromer channel Deposited 2025-10-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 6–148（143 aa） Chain F 6–148（143 aa） Chain G 6–148（143 aa） Chain H 6–148（143 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.05 Å
9X65 Cryo-EM structure of the human KCNQ2/3 heteromer channel in the XEN1101-bound open state Deposited 2025-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	A1EY8 Azetukalner × 4 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 4 K POTASSIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9XB9 Human KCNQ2-CaM in complex with QO-58 and PIP2 Deposited 2025-10-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 4 A1LVR QO-58 × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9XED Human KCNQ2-CaM in complex with QO-83 and PIP2 Deposited 2025-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–149（149 aa） Chain F 1–149（149 aa） Chain G 1–149（149 aa） Chain H 1–149（149 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 4 A1LWZ ~{N}-[2-azanyl-3-fluoranyl-4-[[4-(trifluoromethyl)phenyl]methylamino]phenyl]-3-cyclopentyl-propanamide × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9Y5Q Cryo EM structure of KCa3.1_R355K_I/calmodulin channel in complex with rimtuzalcap Deposited 2025-09-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 3–148（146 aa） Chain F 3–148（146 aa） Chain G 3–148（146 aa） Chain H 3–148（146 aa）	Not recorded	K POTASSIUM ION × 1 A1B92 Rimtuzalcap × 4 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.73 Å
9YDZ Cryo EM structure of KCa3.1_R355K_II/calmodulin channel in complex with rimtuzalcap Deposited 2025-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 82–148（67 aa） Fragment：residues 82-148 Chain F 82–148（67 aa） Fragment：residues 82-148 Chain G 82–148（67 aa） Fragment：residues 82-148 Chain H 82–148（67 aa） Fragment：residues 82-148	Not recorded	K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9YG4 VPS13A/Nt-CaM Deposited 2025-09-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.38 Å
9YQP Cryo-EM structure of the VPS13C N-terminal region in complex with Calmodulin Deposited 2025-10-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.10 Å
9YRM CryoEM Structure of VPS13 protein, 1-1390 from C. thermophilum, in complex with calmodulin Deposited 2025-10-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.75 Å
9YRP Full-length human VPS13C in complex with calmodulin from the CryoEM composite map Deposited 2025-10-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–149（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.13 Å
9ZPO Cryo-EM structure of KCa3.1_I/calmodulin channel in complex with SKA31. Deposited 2025-12-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 3–148（146 aa） Chain F 3–148（146 aa） Chain G 3–148（146 aa） Chain H 3–148（146 aa）	Not recorded	A1C3Q naphtho[1,2-d][1,3]thiazol-2-amine × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å
9ZPT Cryo-EM structure of KCa3.1_II/calmodulin channel in complex with SKA31. Deposited 2025-12-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 82–148（67 aa） Fragment：residues 82-148 Chain F 82–148（67 aa） Fragment：residues 82-148 Chain G 82–148（67 aa） Fragment：residues 82-148 Chain H 82–148（67 aa） Fragment：residues 82-148	Not recorded	K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
9ZRK Cryo-EM structure of KCa3.1_I/calmodulin channel in complex with SKA111. Deposited 2025-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 3–148（146 aa） Chain F 3–148（146 aa） Chain G 3–148（146 aa） Chain H 3–148（146 aa）	Not recorded	A1C3U 5-methylnaphtho[1,2-d][1,3]thiazol-2-amine × 4 K POTASSIUM ION × 4 CA CALCIUM ION × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.99 Å
9ZRL Cryo-EM structure of KCa3.1_II/calmodulin channel in complex with SKA111. Deposited 2025-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 82–148（67 aa） Fragment：residues 82-148 Chain F 82–148（67 aa） Fragment：residues 82-148 Chain G 82–148（67 aa） Fragment：residues 82-148 Chain H 82–148（67 aa） Fragment：residues 82-148	Not recorded	K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
9ZRQ Cryo-EM structure of KCa2.2/calmodulin channel in complex with SKA31. Deposited 2025-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 3–148（146 aa） Chain F 3–148（146 aa） Chain G 3–148（146 aa） Chain H 3–148（146 aa）	Not recorded	K POTASSIUM ION × 4 A1C3Q naphtho[1,2-d][1,3]thiazol-2-amine × 4 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.77 Å
9ZRR Cryo-EM structure of KCa2.2/calmodulin channel in complex with SKA111. Deposited 2025-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 3–146（144 aa） Chain F 3–146（144 aa） Chain G 3–146（144 aa） Chain H 3–146（144 aa）	Not recorded	K POTASSIUM ION × 2 A1C3U 5-methylnaphtho[1,2-d][1,3]thiazol-2-amine × 4 CA CALCIUM ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.31 Å

213 other PDB entries and 279 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CALM1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 625–769； UniProt 5–149

Interleukin-12 receptor subunit beta-2,Calmodulin-1

Mus musculus

UniProt P97378

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 其他Polymer 2 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain D； UniProt 24–637	Not recorded	Interleukin-12 subunit alpha × 1 （P43431） Interleukin-12 subunit beta × 1 （P43432） Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1 × 1 （Q60837,P53355） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions：Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 4.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OE0	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8ODZ Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1). Deposited 2023-03-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 24–637（614 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.60 Å
8PB1 Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 1), obtained after local refinement. Deposited 2023-06-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 24–637（614 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；HEPES-buffered saline (HBS) with added calcium chloride: 25 mM HEPES, pH 7.4, 150 mM NaCl, 5 mM CaCl cryo-EM vitrification conditions Cryogen ETHANE；Leica EM GP2, 5 s. blotting time.	Resolution 3.50 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I12R2_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–614； UniProt 24–637

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8oe0
Deposition date deposition_date	2023-03-10
Structure title title	Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 2).
Keywords keywords	Complex, Cytokine, Receptor, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	55.26 Å
Radius of gyration Rg (electron density) rg_electron	55.42 Å
Forward intensity I(0) i0	443395000.00
Molecular weight molecular_weight	170660.0 kDa
Excluded volume excluded_volume	212090 Å³
Envelope volume envelope_volume	377920 Å³
Hydration-shell volume shell_volume	60664 Å³
Envelope diameter envelope_diameter	188.2 Å
Shell Rg shell_rg	54.78 Å
Envelope Rg envelope_rg	51.81 Å
Shape Rg shape_rg	55.45 Å
Total Rg total_rg	55.27 Å
Total atoms total_atoms	11980
Residues n_residues	1500
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	185.2 Å
Rg (real space) rg_real	55.49 Å
Rg uncertainty (real space) rg_real_error	2.26 Å
I(0) (real space) i0_real	4.4340e+08
I(0) uncertainty (real space) i0_real_error	9.6030e+06
Rg (reciprocal space) rg_reciprocal	55.04 Å
I(0) (reciprocal space) i0_reciprocal	443100000.0000
Solution quality estimate total_estimate	0.8601
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	59.5 Å
Skewness Skewness skewness	0.338
Kurtosis Kurtosis kurtosis	-0.575
Angular range angular_range	— – 0.1400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	16300000.0000
Real-space data points n_real_points	29
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.891; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.961; Smooth: 0.541

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Interleukin-12 subunit alpha
Molecular weight formula_weight	25927.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	11980

RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGTSDEVDGGSGGSGLNDIFEAQKIEWHEGRTKHHHHHH

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Interleukin-12 subunit beta
Molecular weight formula_weight	35837.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1
Molecular weight formula_weight	63789.2 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

QLGASGPGDGCCVEKTSFPEGASGSPLGPRNLSCYRVSKTDYECSWQYDGPEDNVSHVLWCCFVPPNHTHTGQERCRYFSSGPDRTVQFWEQDGIPVLSKVNFWVESRLGNRTMKSQKISQYLYNWTKTTPPLGHIKVSQSHRQLRMDWNVSEEAGAEVQFRRRMPTTNWTLGDCGPQVNSGSGVLGDIRGSMSESCLCPSENMAQEIQIRRRRRLSSGAPGGPWSDWSMPVCVPPEVLPQAKIKFLVEPLNQGGRRRLTMQGQSPQLAVPEGCRGRPGAQVKKHLVLVRMLSCRCQAQTSKTVPLGKKLNLSGATYDLNVLAKTRFGRSTIQKWHLPAQELTETRALNVSVGGNMTSMQWAAQAPGTTYCLEWQPWFQHRNHTHCTLIVPEEEDPAKMVTHSWSSKPTLEQEECYRITVFASKNPKNPMLWATVLSSYYFGGNASRAGTPRHVSVRNQTGDSVSVEWTASQLSTCPGVLTQYVVRCEAEDGAWESEWLVPPTKTQVTLDGLRSRVMYKVQVRADTARLPGAWSHPQRFSFEGTGGSGGSGGAARKKWKQSVRLISLCQRLS

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Interleukin-12 receptor subunit beta-2,Calmodulin-1
Molecular weight formula_weight	85723.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

NIDVCKLGTVTVQPAPVIPLGSAANISCSLNPKQGCSHYPSSNELILLKFVNDVLVENLHGKKVHDHTGHSSTFQVTNLSLGMTLFVCKLNCSNSQKKPPVPVCGVEISVGVAPEPPQNISCVQEGENGTVACSWNSGKVTYLKTNYTLQLSGPNNLTCQKQCFSDNRQNCNRLDLGINLSPDLAESRFIVRVTAINDLGNSSSLPHTFTFLDIVIPLPPWDIRINFLNASGSRGTLQWEDEGQVVLNQLRYQPLNSTSWNMVNATNAKGKYDLRDLRPFTEYEFQISSKLHLSGGSWSNWSESLRTRTPEEEPVGILDIWYMKQDIDYDRQQISLFWKSLNPSEARGKILHYQVTLQEVTKKTTLQNTTRHTSWTRVIPRTGAWTASVSAANSKGASAPTHINIVDLCGTGLLAPHQVSAKSENMDNILVTWQPPKKADSAVREYIVEWRALQPGSITKFPPHWLRIPPDNMSALISENIKPYICYEIRVHALSESQGGCSSIRGDSKHKAPVSGPHITAITEKKERLFISWTHIPFPEQRGCILHYRIYWKERDSTAQPELCEIQYRRSQNSHPISSLQPRVTYVLWMTAVTAAGESPQGNEREFCPQGKANGTGGSGGSGGLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Homo sapiens

Entity 5 Entity 5 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 6 Entity 6 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	3

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.60 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	209938

fit	/app/data/saxs_computation/oe/8oe0/8oe0.fit
pddf	/app/data/pr_computation/oe/8oe0/8oe0.pr.out
profile	/app/data/saxs_computation/oe/8oe0/8oe0.dat

Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 2).

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-12 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Interleukin-12 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1

State in the Current Structure

Other States of the Same Protein in the Database

Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1

State in the Current Structure

Other States of the Same Protein in the Database

Interleukin-12 receptor subunit beta-2,Calmodulin-1

State in the Current Structure

Other States of the Same Protein in the Database

Interleukin-12 receptor subunit beta-2,Calmodulin-1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)