9rmc

Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3.1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H31_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–139； UniProt 1–136 Author chain E； PDBConstruct 4–139； UniProt 1–136

Histone H4

Homo sapiens

UniProt P62805

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 4–106； UniProt 1–103 Author chain F； PDBConstruct 4–106； UniProt 1–103

Histone H2A type 1-B/E

Homo sapiens

UniProt P04908

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1B_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 4–133； UniProt 1–130 Author chain G； PDBConstruct 4–133； UniProt 1–130

Histone H2B type 1-J

Homo sapiens

UniProt P06899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B1J_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 4–128； UniProt 1–125 Author chain H； PDBConstruct 4–128； UniProt 1–125

Transcription activator BRG1

OrganismNot specified

UniProt P51532

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMCA4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–1647； UniProt 1–1647

Actin-like protein 6A

OrganismNot specified

UniProt O96019

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACL6A_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–429； UniProt 1–429

Actin, cytoplasmic 1, N-terminally processed

OrganismNot specified

UniProt P60709

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain K； PDBConstruct 1–375； UniProt 1–375

AT-rich interactive domain-containing protein 1A

OrganismNot specified

UniProt O14497

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARI1A_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain L； PDBConstruct 1–2285； UniProt 1–2285

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1

OrganismNot specified

UniProt Q12824

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNF5_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–385； UniProt 1–385

SWI/SNF complex subunit SMARCC2

OrganismNot specified

UniProt Q8TAQ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMRC2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–1214； UniProt 1–1214 Author chain O； PDBConstruct 1–1214； UniProt 1–1214

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1

OrganismNot specified

UniProt Q96GM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMRD1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain P； PDBConstruct 1–515； UniProt 1–515

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1

OrganismNot specified

UniProt Q969G3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMCE1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Q； PDBConstruct 1–411； UniProt 1–411

Zinc finger protein ubi-d4

Homo sapiens

UniProt Q92785

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	REQU_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain R； PDBConstruct 1–391； UniProt 1–391

Green fluorescent protein,POU domain, class 5, transcription factor 1

Homo sapiens

UniProt P42212

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GFP_AEQVI
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain V； PDBConstruct 27–263； UniProt 2–238

Green fluorescent protein,POU domain, class 5, transcription factor 1

Homo sapiens

UniProt Q01860

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Transcription factor SOX-2 × 1 （P48431） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PO5F1_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain V； PDBConstruct 274–633； UniProt 1–360

Transcription factor SOX-2

Homo sapiens

UniProt P48431

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20 DNA 2	Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1, N-terminally processed × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） Green fluorescent protein,POU domain, class 5, transcription factor 1 × 1 （P42212,Q01860） DNA (148-MER) × 1 DNA (148-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SOX2_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain W； PDBConstruct 24–105； UniProt 37–118

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rmc
Deposition date deposition_date	2025-06-18
Structure title title	Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1
Keywords keywords	Chromatin, remodeler, GENE REGULATION; GENE REGULATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9rmc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9rmc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9rmc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	63.97 Å
Rg (electron density)	63.63 Å
Total Rg	63.53 Å
Atom count	27953
Residues	3888
Excluded volume	465380 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9rmc__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	Histone H3.1
Molecular weight formula_weight	15719.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	27953

GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Histone H4
Molecular weight formula_weight	11676.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

GSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Histone H2A type 1-B/E
Molecular weight formula_weight	14447.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Histone H2B type 1-J
Molecular weight formula_weight	14088.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

GSHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Transcription activator BRG1
Molecular weight formula_weight	184923.8 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED

Entity 6 Entity 6 polymer

Description description	Actin-like protein 6A
Molecular weight formula_weight	47509.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP

Entity 7 Entity 7 polymer

Description description	Actin, cytoplasmic 1, N-terminally processed
Molecular weight formula_weight	41782.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 8 Entity 8 polymer

Description description	AT-rich interactive domain-containing protein 1A
Molecular weight formula_weight	242250.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS

Entity 9 Entity 9 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Molecular weight formula_weight	44199.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW

Entity 10 Entity 10 polymer

Description description	SWI/SNF complex subunit SMARCC2
Molecular weight formula_weight	133048.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,O

MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHHHHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ

Entity 11 Entity 11 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
Molecular weight formula_weight	58311.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT

Entity 12 Entity 12 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Molecular weight formula_weight	46710.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE

Entity 13 Entity 13 polymer

Description description	Zinc finger protein ubi-d4
Molecular weight formula_weight	48554.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSSGTLEVLFQGPGGSGSAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	Green fluorescent protein,POU domain, class 5, transcription factor 1
Molecular weight formula_weight	70735.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MDWSHPQFEKSAVDENLYFQGGGRMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKEAAAKEAAAKMAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSNLPETGGHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 15 Entity 15 polymer

Description description	Transcription factor SOX-2
Molecular weight formula_weight	12718.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MDWSHPQFEKSAVDENLYFQGGMSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 16 Entity 16 polymer

Description description	DNA (148-MER)
Molecular weight formula_weight	69794.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

CCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGGATATCCTGGAGAATCCCGGTCTGCAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCCTTTGTTATGCAAATACATCCTGTCGGGATCCTAATGACCAAGGAAAGCATGATTCTTCACACC

Entity 17 Entity 17 polymer

Description description	DNA (148-MER)
Molecular weight formula_weight	70389.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

GGTGTGAAGAATCATGCTTTCCTTGGTCATTAGGATCCCGACAGGATGTATTTGCATAACAAAGGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTGCAGACCGGGATTCTCCAGGATATCCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGG

Entity 18 Entity 18 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	4.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	30808

Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A type 1-B/E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B type 1-J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription activator BRG1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-like protein 6A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1, N-terminally processed

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AT-rich interactive domain-containing protein 1A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWI/SNF complex subunit SMARCC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer