SAXSdb — 6mb2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interferon-inducible protein AIM2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Green fluorescent protein × 15 （P42212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AIM2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–94； UniProt 1–93 Author chain B； PDBConstruct 2–94； UniProt 1–93 Author chain C； PDBConstruct 2–94； UniProt 1–93 Author chain D； PDBConstruct 2–94； UniProt 1–93 Author chain E； PDBConstruct 2–94； UniProt 1–93 Author chain F； PDBConstruct 2–94； UniProt 1–93 Author chain G； PDBConstruct 2–94； UniProt 1–93 Author chain H； PDBConstruct 2–94； UniProt 1–93 Author chain I； PDBConstruct 2–94； UniProt 1–93 Author chain J； PDBConstruct 2–94； UniProt 1–93 Author chain K； PDBConstruct 2–94； UniProt 1–93 Author chain L； PDBConstruct 2–94； UniProt 1–93 Author chain M； PDBConstruct 2–94； UniProt 1–93 Author chain N； PDBConstruct 2–94； UniProt 1–93 Author chain O； PDBConstruct 2–94； UniProt 1–93

Green fluorescent protein

Aequorea victoria

UniProt P42212

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Interferon-inducible protein AIM2 × 15 （O14862）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GFP_AEQVI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–226； UniProt 2–229 Author chain b； PDBConstruct 1–226； UniProt 2–229 Author chain c； PDBConstruct 1–226； UniProt 2–229 Author chain d； PDBConstruct 1–226； UniProt 2–229 Author chain e； PDBConstruct 1–226； UniProt 2–229 Author chain f； PDBConstruct 1–226； UniProt 2–229 Author chain g； PDBConstruct 1–226； UniProt 2–229 Author chain h； PDBConstruct 1–226； UniProt 2–229 Author chain i； PDBConstruct 1–226； UniProt 2–229 Author chain j； PDBConstruct 1–226； UniProt 2–229 Author chain k； PDBConstruct 1–226； UniProt 2–229 Author chain l； PDBConstruct 1–226； UniProt 2–229 Author chain m； PDBConstruct 1–226； UniProt 2–229 Author chain n； PDBConstruct 1–226； UniProt 2–229 Author chain o； PDBConstruct 1–226； UniProt 2–229

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6mb2
Deposition date deposition_date	2018-08-29
Structure title title	Cryo-EM structure of the PYD filament of AIM2
Keywords keywords	Filament, higher order, innate immunity, inflammasome, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6mb2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6mb2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6mb2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	62.08 Å
Rg (electron density)	61.53 Å
Total Rg	61.35 Å
Atom count	37650
Residues	4725
Excluded volume	670460 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6mb2__assembly_1__model_1`	30-meric （30）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Interferon-inducible protein AIM2
Molecular weight formula_weight	10839.6 kDa
Source method src_method	man
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O
Atom count atom_count	37650

AMESKYKEILLLTGLDNITDEELDRFKGFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Green fluorescent protein
Molecular weight formula_weight	25924.6 kDa
Source method src_method	man
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o

SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFXVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI

Source Source

Source organism organism	Aequorea victoria
Common name common_name	Jellyfish
NCBI taxonomy ID ncbi_taxonomy_id	6100
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	5.000 Å
Low-resolution limit resolution_low	150.000 Å
R factor r_factor	0.3606
R_work r_work	0.3574
R_free r_free	0.4227

Resolution resolution	5.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	54973

Cryo-EM structure of the PYD filament of AIM2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interferon-inducible protein AIM2

State in the Current Structure

Other States of the Same Protein in the Database

Green fluorescent protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6mb2__assembly_1__model_1

6mb2__assembly_1__model_1 | I(q)

6mb2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of the PYD filament of AIM2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interferon-inducible protein AIM2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Green fluorescent protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6mb2__assembly_1__model_1

6mb2__assembly_1__model_1 | I(q)

6mb2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)